CAZyme Information: MGYG000002994_00888

Basic Information

• Species: Megasphaera sp002319965
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Megasphaera; Megasphaera sp002319965
• CAZyme ID: MGYG000002994_00888
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
584		65118.82	8.7546

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002994	2223689	MAG	United States	North America

• Gene Location: Start: 12066; End: 13820 Strand: +

Full Sequence      

MKYNRAMKLSCLTGLITLSLTAFSFAAAPDDGAKATDPAFNVPTVANPIPDEVVKDLEIV
EDQGRWLVSDKALRRYGIKEADKSKGTYWFRLPKAENGSTAWQGAPVQLTLPGRAVSGGR
TINIKNVRRPLGISYVLAENPTEKNSLLPPEQPVSAAPELHREGDRQPALGKEGKMGLVL
FWDPLMKEDADLPSLQTRQPIMSPTAFRLTKSGIELRNPDFDMLAETYAEKGYAMWPLVD
NNFDPKLTHEILSDSRLQDTMVRQLMGYAILYDFKGYNLDFENINYSDKDKLTAFVRKIS
DAAHAYGLKLSMDVTPPSDSPNWSMVYDRAALAPHLDYLMIMAYDQVGRTSPVAGPVATY
PWVERAVQNTLKLAPADKIVLGMPLYMRLWYESKDGRDLPQNISDWPAVVGAPPVKAAKA
DVRKDEDQAKVNEPMRVEVKTAAEEAALVADENRKGVVIPIDFDGDTYKRATVKPVKKTA
KPDVSKTPVGSGKAKLFVRTLTMADSEAVLKAYKNYVVWKPDLGLYYLELPLKTGTVKIW
IEDEKSLKAKAELIQTYGLKGAAFWRKGFEPTHFWQGFAKHELT

Enzyme Prediction     

No EC number prediction in MGYG000002994_00888.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	248	568	2.1e-34	0.7027027027027027

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	2.72e-54	191	575	15	310	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	1.48e-32	200	575	132	415	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
smart00636	Glyco_18	1.95e-16	249	421	83	267	Glyco_18 domain.
pfam00704	Glyco_hydro_18	4.23e-15	272	390	103	227	Glycosyl hydrolases family 18.
cd02872	GH18_chitolectin_chitotriosidase	1.78e-12	242	388	81	245	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCC74348.1	4.81e-313	1	584	1	588
AVO74965.1	4.81e-313	1	584	1	588
AVO27694.1	1.95e-312	1	584	1	588
ALG42233.1	2.27e-311	1	584	1	588
AXB82715.1	4.11e-199	3	584	2	522

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4Q6T_A	1.63e-18	243	386	83	236	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]
5JH8_A	2.64e-13	240	399	73	232	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]
4WIW_A	6.27e-09	232	402	73	249	ChainA, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_B Chain B, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_C Chain C, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_D Chain D, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_E Chain E, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_F Chain F, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2]
4S3K_A	6.08e-08	202	418	138	360	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
4S3J_A	8.00e-08	240	409	178	349	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31682	8.62e-20	201	394	28	216	Putative glycosylase YkvQ OS=Bacillus subtilis (strain 168) OX=224308 GN=ykvQ PE=3 SV=1
O32258	4.84e-17	227	406	78	263	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1
P0DPJ9	1.07e-07	240	409	177	348	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
Q9K3E4	1.33e-06	240	409	177	348	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1
C0H404	2.82e-06	531	581	32	82	Probably inactive glycosylase YkzR OS=Bacillus subtilis (strain 168) OX=224308 GN=ykzR PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000426	0.998506	0.000352	0.000269	0.000210	0.000174

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002994_00888.