CAZyme Information: MGYG000002984_01277

Basic Information

• Species: UBA737 sp900554525
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA737; UBA737 sp900554525
• CAZyme ID: MGYG000002984_01277
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
677		77193.04	6.1037

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002984	1653947	MAG	United States	North America

• Gene Location: Start: 1326; End: 3359 Strand: -

Full Sequence      

MKSLIFPHGDWISHECASALQPTDILAAQHNEIMPVMSDSLKNRHFLFRKRFDCKHNGEA
VKLRITADDYYKFTINGRIIGQGPAQGYSFCYYWNEYNLSGMLKNGKNEIMVDVYYHGLP
CRAYNSGDNRIGLIAEIRQGNKCILCTGCDWECADYSAYGKSQVTGADTYFPEDFDSRAE
LIWRRCYSIDADYIFSPEPVKPVVRYFKKPLKEERLEDGSIFYDFGREITAMLEIKAKGN
DGDSVFILCGEEAEGTDVRYKLRCNCEYKEKLILSDGENSHEQYDYKGFRYVKLIPCGNI
SELSLTAVVRHYPFDDKYCILKTCDAQLKSIFEMCKNSVKYGAQEVYIDCPTREKGQYSG
DLLVTGSAHMILTGNGELFKKALDNFMQSSGYSETLLAVAPGSYLQEIADYSLIFPLLAL
QYYKFSDDRAYLCKNLEICRKIINGFKVYERRDGLLCGVNDKWNLVDWPAELRDGYDFRL
EPPDGQPHNVLNALYIGCVILTEKISEILGIAYPKRSKELITSFNAEFYDPASKIYTDCK
SSGHSALHSNILPVFFDFAEKEAQDNILKMVMNKGLSCGVYFSYFVLKALCKTGRYNEAL
ELILSDGRHSWLHMLSEGATTCFEAWGKEQKHNTSLCHPWASAPIIVLAEDILPNIPSVG
EIIYGKRLNRQSEYFKA

Enzyme Prediction     

No EC number prediction in MGYG000002984_01277.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	215	652	1.6e-85	0.8670634920634921
CBM67	41	180	2.1e-22	0.7727272727272727

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.51e-34	321	645	6	333	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	5.34e-05	215	311	2	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH20286.1	1.68e-199	11	675	9	697
AYQ75662.1	1.60e-191	39	665	18	663
QCT01521.1	3.65e-179	11	653	9	671
AFH60330.1	7.00e-173	11	653	9	671
QBE96895.1	3.87e-169	10	652	7	661

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.17e-12	47	628	178	809	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	1.48e-12	43	626	129	742	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
4XHC_A	2.28e-08	323	644	211	534	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002984_01277.