CAZyme Information: MGYG000002982_00455

Basic Information

• Species: Streptococcus rubneri
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus rubneri
• CAZyme ID: MGYG000002982_00455
• CAZy Family: GH8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367		42672.64	8.6233

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002982	1039311	MAG	United States	North America

• Gene Location: Start: 1091; End: 2194 Strand: -

Full Sequence      

MRTKKMKYLWFVVILAIFCLTLFLARSRSKVLMRNRIYRQWSEHFVVKDGKEAYVRTTNS
DKNTVVLSEAQSYGMLITVEAASKGLASQEDFDRLYRYYKNHRLDDTQLMSWKQIINKGK
VTVEDQNATDGDLYIAYALIQASNQWPKQAKEYQKQAKAILEDILKYNFNEDTGVLTVGN
WANQDSEFYNLMRTSDTLPHYFQVFYQLSGNGQWLKIKDEMLKRLDQISSHHETGLLPDF
IWADEEGTRIADPKTIESKYDGAYSYNACRLPYNLAKSQDKTSQKLVKKMLDFFMKQRNI
HAGYDLKGNALNQHQAASFIAPVVYAAADENDYLKLVQQSKYIFMQDLPLGNYYDATMTT
MIALDLF

Enzyme Prediction     

No EC number prediction in MGYG000002982_00455.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	38	363	7.6e-74	0.978125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3405	BcsZ	2.93e-28	5	330	1	318	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
pfam01270	Glyco_hydro_8	2.71e-26	38	364	8	317	Glycosyl hydrolases family 8.
PRK11097	PRK11097	2.31e-09	38	270	28	248	cellulase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGY40742.1	2.05e-215	1	367	1	367
AGY37425.1	2.05e-215	1	367	1	367
SQH65600.1	2.05e-215	1	367	1	367
AYF93492.1	2.91e-215	1	367	1	367
VEE18714.1	5.60e-213	1	367	1	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XD0_A	4.50e-36	33	322	58	359	ApoStructure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4],5XD0_B Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4]
1V5C_A	6.12e-24	68	337	73	350	Thecrystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]
7CJU_A	6.84e-24	68	337	79	356	Crystalstructure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]
6VC5_A	4.17e-10	35	276	2	231	1.6Angstrom Resolution Crystal Structure of endoglucanase from Komagataeibacter sucrofermentans [Komagataeibacter sucrofermentans]
1WZZ_A	4.65e-07	68	272	48	242	Structureof endo-beta-1,4-glucanase CMCax from Acetobacter xylinum [Komagataeibacter xylinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19254	6.57e-35	51	322	70	359	Beta-glucanase OS=Niallia circulans OX=1397 GN=bgc PE=3 SV=1
P29019	8.89e-21	38	326	91	395	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1
P27032	1.86e-08	41	283	30	256	Minor endoglucanase Y OS=Dickeya dadantii (strain 3937) OX=198628 GN=celY PE=1 SV=1
P37696	1.96e-07	68	272	56	250	Probable endoglucanase OS=Komagataeibacter hansenii OX=436 GN=cmcAX PE=1 SV=1
Q8X5L9	1.20e-06	38	266	28	248	Endoglucanase OS=Escherichia coli O157:H7 OX=83334 GN=bcsZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.950786	0.040409	0.007782	0.000172	0.000116	0.000745

TMHMM  Annotations     

start	end
7	25