CAZyme Information: MGYG000002967_02306

Basic Information

• Species: Enterococcus_A pallens
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_A; Enterococcus_A pallens
• CAZyme ID: MGYG000002967_02306
• CAZy Family: GT113
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
342		38942.29	4.8387

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002967	2610517	MAG	United States	North America

• Gene Location: Start: 34937; End: 35965 Strand: +

Full Sequence      

MANWLTFIIEGESVDSVSKARHDISLIGDSIGFQRLYIYRYIDVHEDDKALVARIDGITS
GVSAGDIIVYQYPSYNSYRFELTFLQRLKNRGAKVALLIHDSELLRGNNTPEELELFNQA
DWLITHSQQMEQQFCEMGIKTPMLTKPLFDYLITDKAALDASLDKRIVFAGNIQKSIFLS
SWQSKTKVAAFGTKGELQLSQGVSYCGTFQQEELLKEMPKNCFGIAWDDDLQQGGNYQNY
TRYNAPHKVSLYLALGLPVIVWKESAIAQLVADYQLGFAIHSLEEIDEIFESISAEELLK
LKRRTNQFSQLVRKGIFTKNALLQVESNILFKEVEDSECQTE

Enzyme Prediction     

No EC number prediction in MGYG000002967_02306.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	12	326	3e-95	0.9782608695652174

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	1.28e-103	1	329	1	333	sugar transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZO10882.1	5.49e-146	1	335	1	336
QXJ61598.1	8.12e-145	1	335	1	336
AUJ86394.1	6.33e-118	1	330	1	330
AMG48339.1	2.56e-117	1	330	1	330
QCT91932.1	5.91e-116	1	338	1	338

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4W6Q_A	3.93e-39	9	322	10	322	GlycosyltransferaseC from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_B Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_C Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_D Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1]
3QKW_A	5.60e-38	9	324	10	324	Structureof Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_B Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_C Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_D Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis]
3RHZ_A	6.51e-38	9	324	18	332	Structureand functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis],3RHZ_B Structure and functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0H2UR93	3.23e-49	16	323	16	327	Glucosyltransferase 3 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtf3 PE=1 SV=1
Q9AEU1	1.29e-47	20	330	20	333	Glucosyltransferase 3 OS=Streptococcus gordonii OX=1302 GN=gtf3 PE=3 SV=1
A0A0M3KKZ0	2.06e-38	9	322	8	320	Glucosyltransferase 3 OS=Streptococcus agalactiae serotype III (strain COH1) OX=342616 GN=gtf3 PE=1 SV=2
B5A7L9	2.94e-37	9	324	8	322	Glucosyltransferase 3 OS=Streptococcus parasanguinis OX=1318 GN=gtf3 PE=1 SV=1
B3XPQ7	2.37e-36	11	331	10	334	Glucosyltransferase 3 OS=Limosilactobacillus reuteri (strain DSM 17509 / CIP 109821 / 100-23) OX=349123 GN=gtf3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002967_02306.