CAZyme Information: MGYG000002960_01683

Basic Information

• Species: Prevotella sp900555035
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900555035
• CAZyme ID: MGYG000002960_01683
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
554		62211.04	8.3816

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002960	3004760	MAG	China	Asia

• Gene Location: Start: 6323; End: 7987 Strand: -

Full Sequence      

MLRDDKKMKIKSFLIASLAAFSLTAGAQSLSPNTKWHWDKGTIVVETPERPAGQQNVLGL
KAPKLQTVRVGFVGLGMRGPWAVMRFCHIPGVEIVALCDYEENRAEKSQEYLRKQGLKPA
AIYSGEKGYEELCKRQDIDLVYIAADWNHHFPVAQCAMENGKHTAIEVPSAMNLDQCWSL
INMSEKTRKHCFILENCCYDYYEMNALAMAQDGVFGNIIRAEGAYIHCLEDFWDAYWKDP
NDNDKDNLHWRMKYNMENRGDVYPTHGLGPVAQCLNIHRGDRFTTLVAMDTESFVGKDWV
SKKSGKECKEYRNGDHTTTLMRTAKGKVVEIQHNVMTPQPYNRLFKLTGTKGYATKYPTE
EFALSGDALKGTGAPQMDNLNAHGFMNKEQKAALIKKYYHPILKKYGELGRQMGHGGMDF
IMDSRLVYCLQNGLPLDMDVYDLAEWCSLAELGAISMDNNSASVTFPDFTRGFWNKEQGY
KHQYASPADEAATEAAAAAYTKAQKEATAKYNLWKLYDDVAAAKKANNAKALKSATAKYN
KAVAAAKKAMAGKK

Enzyme Prediction     

No EC number prediction in MGYG000002960_01683.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	64	476	1e-152	0.9924812030075187

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	1.59e-18	66	378	2	281	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	1.37e-11	68	193	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	1.28e-04	67	218	4	145	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABR38645.1	5.30e-304	8	528	1	523
QQY38775.1	5.30e-304	8	528	1	523
QFQ13386.1	5.42e-269	6	522	2	520
QCQ31109.1	4.69e-267	7	510	7	509
ALK83890.1	1.99e-259	24	510	24	509

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	6.75e-92	50	474	25	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	4.05e-67	68	474	21	431	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
1ZH8_A	9.08e-06	65	352	16	267	Crystalstructure of Oxidoreductase (TM0312) from Thermotoga maritima at 2.50 A resolution [Thermotoga maritima MSB8],1ZH8_B Crystal structure of Oxidoreductase (TM0312) from Thermotoga maritima at 2.50 A resolution [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6KYY1	1.06e-304	8	528	1	523	Glycosyl hydrolase family 109 protein 3 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0950 PE=3 SV=1
A6L1Z2	2.29e-259	24	510	24	509	Glycosyl hydrolase family 109 protein 5 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_2041 PE=3 SV=1
A6KWM1	1.67e-253	9	510	3	508	Glycosyl hydrolase family 109 protein 4 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0105 PE=3 SV=1
Q89ZX8	1.53e-193	10	485	1	466	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1
Q5LGZ0	3.44e-189	14	485	8	463	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=BF0853 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000620	0.997760	0.000982	0.000258	0.000198	0.000161

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002960_01683.