CAZyme Information: MGYG000002959_00446

Basic Information

• Species: Peptoniphilus_A lacydonensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Peptoniphilaceae; Peptoniphilus_A; Peptoniphilus_A lacydonensis
• CAZyme ID: MGYG000002959_00446
• CAZy Family: GH73
• CAZyme Description: Exo-glucosaminidase LytG

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
191		22297.6	9.1305

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002959	1622414	MAG	United States	North America

• Gene Location: Start: 100026; End: 100601 Strand: -

Full Sequence      

MKIKKTGCGFFVILVFFVVIVGIMNLLISNSSNRKAYDEENYRQKYIEDTASMAVKISKK
YKLFPSVMLAQSILESDWGRSELSKEYNNYFGIKEVKKGEGIVFETEEYVEGESGRYMEN
FKKYPSKKDSFLHYAKLLTEAKRYEKVKTAKNYEEAIQYIIEGGYATDPDYKNKVISVIE
KYNLNKYDDVK

Enzyme Prediction     

No EC number prediction in MGYG000002959_00446.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	52	184	5.7e-36	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	1.17e-51	24	191	25	191	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
TIGR02541	flagell_FlgJ	4.07e-30	46	181	151	292	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.
PRK08581	PRK08581	4.28e-29	38	191	316	475	amidase domain-containing protein.
PRK05684	flgJ	1.83e-27	53	181	162	296	flagellar assembly peptidoglycan hydrolase FlgJ.
NF038016	sporang_Gsm	1.55e-24	43	188	160	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEJ35583.1	6.80e-90	1	190	1	190
QQE46577.1	6.80e-90	1	190	1	190
QQT90265.1	1.95e-89	1	190	1	190
CDZ75698.1	1.80e-45	27	189	25	185
ATF25816.1	6.13e-40	2	188	6	193

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	1.09e-26	42	188	29	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	2.28e-17	30	189	48	213	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	4.11e-15	67	181	27	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	5.59e-15	67	181	27	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	8.54e-14	44	179	2	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.36e-30	35	190	40	200	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
A2RHZ5	1.81e-19	41	188	60	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
Q9CIT4	1.83e-19	41	188	60	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
P0C2T5	4.66e-19	41	188	60	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
P37710	3.03e-18	46	188	183	333	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.958857	0.033354	0.002599	0.000150	0.000116	0.004945

TMHMM  Annotations     

start	end
7	29