CAZyme Information: MGYG000002950.1_01228

Basic Information

• Species: Leptotrichia wadei
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Leptotrichiaceae; Leptotrichia; Leptotrichia wadei
• CAZyme ID: MGYG000002950.1_01228
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
299		35473.24	10.3032

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002950.1	1471153	MAG	United States	North America

• Gene Location: Start: 9; End: 908 Strand: +

Full Sequence      

MQFIRENEVETVIFVDFGGFNLKFFELLKKKILKKELQNLRMVYYIPPKVWAWGKGRIKK
LRKFDDVIVIFPFEKEYYDESLRKDKSKGLKVEYFGNPFVDKYDFSDKLGKKILLLPGSR
RQEIEKFLSIIVKLIRNEKVKNEKFLMKLANEEHKKYIRDFKEKYKIDVLKIPNLEITFD
EIKNIRKDCKYAIATSGTVTFEISLMGLPVIVVYKTSAINAFIARHIVKIKYITLTNLNA
DKEIFKELLQEDFSVEKLLKEMGIMEKNKKNIVLELKKEREKLGNFGVLKKIANYLLKK

Enzyme Prediction     

No EC number prediction in MGYG000002950.1_01228.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	2	271	3.7e-73	0.7372881355932204

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0763	LpxB	2.98e-64	2	283	79	351	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	8.71e-60	2	262	79	335	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	2.30e-43	2	291	76	366	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.01e-38	2	281	83	360	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	8.82e-38	8	298	76	346	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBM47832.1	1.99e-207	1	299	90	388
BBM50136.1	1.99e-207	1	299	90	388
BBM43113.1	7.72e-205	1	299	90	388
BBM54725.1	5.50e-198	1	299	90	388
BBM40676.1	9.84e-190	1	298	90	387

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.30e-18	5	258	85	337	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.77e-18	5	258	85	337	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C0QR27	5.03e-38	4	296	76	373	Lipid-A-disaccharide synthase OS=Persephonella marina (strain DSM 14350 / EX-H1) OX=123214 GN=lpxB PE=3 SV=1
B3E4H8	4.15e-36	2	297	84	377	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q74AT9	3.21e-33	2	297	84	377	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q39T49	3.24e-31	2	297	84	377	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
B6J9H1	2.05e-30	2	252	81	323	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuK_Q154) OX=434924 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999973	0.000062	0.000003	0.000000	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002950.1_01228.