CAZyme Information: MGYG000002946_03644

Basic Information

• Species: Enterocloster sp900555905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp900555905
• CAZyme ID: MGYG000002946_03644
• CAZy Family: GH10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
437		51450.22	5.3757

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002946	4682631	MAG	United States	North America

• Gene Location: Start: 1640; End: 2953 Strand: -

Full Sequence      

MSQTYLKYFEEQRAQMEARVELDTRRNRKAFAKIRITDQTGAPVTGVKVRVEQKSHDFKF
GCNLFMLDQFPDEARNQAYRKEFKELFNYGVSPFYWADFELTDGAPRMGENPPEVYRRPA
PEKILRYCGENGIEVKGHPLFWHKFLPDWLPNDRDQVFYRLDRRLRELSAEYGDRIRDWD
CVNESLTQPCRYMRDTRLPRDYPGSIFKKAAKYFTNNRLFINDVTEIAWDDELGELSAYH
MQIENLLLKGTPVDAIGMQYHMFYTPEELEKRAAQFYNPECLFNCMDLYGAFGLPLHVSE
VTVPAYGGTKENMELQAEITEMLYRIWFSHAQMEGIVWWNLVDGTAAYAPFGSFDGENYY
AGGLLNHDMTPKPVYHVLKRLIQQEWHTREDIGAMPQEHLFEGFFGKYDVEVEMNGETVH
REFHLSKYGPREFTIAL

Enzyme Prediction     

No EC number prediction in MGYG000002946_03644.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	52	378	2.9e-43	0.9702970297029703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00633	Glyco_10	1.08e-35	123	375	20	260	Glycosyl hydrolase family 10.
COG3693	XynA	2.66e-26	110	379	73	338	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].
pfam00331	Glyco_hydro_10	1.38e-23	122	375	62	305	Glycosyl hydrolase family 10.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44415.1	4.05e-117	14	436	19	439
AXE20297.1	2.60e-104	48	435	59	439
AEI51978.1	1.04e-103	16	435	31	439
AHF90707.1	2.23e-99	6	435	16	453
QMW04637.1	5.28e-99	16	437	31	446

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D88_A	5.91e-27	34	435	62	423	ChainA, Beta-xylanase [Bacillus sp. (in: Bacteria)]
7D89_A	3.78e-26	34	435	62	423	ChainA, Beta-xylanase [Bacillus sp. (in: Bacteria)]
4L4O_A	5.81e-21	114	343	63	301	Thecrystal structure of CbXyn10B in native form [Caldicellulosiruptor bescii DSM 6725]
1VBR_A	8.58e-21	122	390	69	328	Crystalstructure of complex xylanase 10B from Thermotoga maritima with xylobiose [Thermotoga maritima],1VBR_B Crystal structure of complex xylanase 10B from Thermotoga maritima with xylobiose [Thermotoga maritima],1VBU_A Crystal structure of native xylanase 10B from Thermotoga maritima [Thermotoga maritima],1VBU_B Crystal structure of native xylanase 10B from Thermotoga maritima [Thermotoga maritima]
4PMD_A	3.33e-20	114	343	63	301	Crystalstructure of CbXyn10B from Caldicellulosiruptor bescii and its mutant(E139A) in complex with hydrolyzed xylotetraose [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q60041	1.39e-17	122	389	88	346	Endo-1,4-beta-xylanase B OS=Thermotoga neapolitana OX=2337 GN=xynB PE=3 SV=1
O69230	2.11e-16	122	406	431	757	Endo-1,4-beta-xylanase C OS=Paenibacillus barcinonensis OX=198119 GN=xynC PE=1 SV=1
P23556	4.87e-16	123	343	76	306	Endo-1,4-beta-xylanase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynA PE=1 SV=1
I1S3T9	1.61e-13	122	262	90	235	Endo-1,4-beta-xylanase C OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=XYLC PE=1 SV=1
Q02290	7.32e-13	130	383	89	326	Endo-1,4-beta-xylanase B OS=Neocallimastix patriciarum OX=4758 GN=xynB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002946_03644.