CAZyme Information: MGYG000002943_02199

Basic Information

• Species: Actinomyces oris
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Actinomyces; Actinomyces oris
• CAZyme ID: MGYG000002943_02199
• CAZy Family: GH2
• CAZyme Description: Evolved beta-galactosidase subunit alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1059		118911.55	4.771

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002943	3026158	MAG	United States	North America

• Gene Location: Start: 1727; End: 4906 Strand: +

Full Sequence      

MIVPRHFEDLDVLHEHTLPPRSYYVPASRATATSPWRREDSDRFHLLSGQWAFRYLPSIH
ELTEPFWEQDAPVGTSDGDEPGQADPAHLPEGFTMIQVPSTWQHLGYDHHQYTNVRYPIP
FDPPYVPQDNPCGAYIRDFDYTPDPAAPSTYLTFEGVDSCFYVWLNGTYVGYSQVSHASA
EFDVTELLRPGANRLAVLVLKWCDGTYLEDQDKFRTSGIFRDVYLLSRPAAVLFDYVTTT
SLGPISGTGLDAGPATALVRIQGAFRGGPVPTSVELIDHDGAVVAAGELEPFAGDDGYTH
RARLTVEAPHLWSAEDPYLYTLVITTPGEVITDRVGIREVAVSDAVVHLNGRPITLRGVN
RHDSDPTTGPVVDLEHMLWDLRLMKEHNINAVRSSHYPNDPRFYQLCDEHGFYVMSEADN
ESHGTQSRFLADPSWDNQVEHWNEPIADNPEWTEATVDRMRLCVHREKNRPSIISWSAGN
ECSYGCTLEAALFWAKDFDPTRLTHYESSYYRDSKRRYDYSCIDLYSRMYPAIEEIRDYL
DSDPDKPFILVEYCHAMGNSPGDLEDYWEIIRADERMCGGFVWEWCDHAVTAGTSDDGRP
IQLYGGDHDEAVHDGNFCVDGLVSPDRVPHPGLAELKNVQRPARVIEYDQDEGLLTIHND
LDHTDLSQYLRISYEVRCDGVVVDREDLDLVEPVPPHTSVMLRCEPSVPPTGRCHLLVTY
RLARPDSLLAAGHVLGFDEIALRNADRRHRWVASLADRPIGETRLPVRREGTRIEVDSDR
LSCAIDTRTGLPVSLSSEGRELLQRPVELNIWRAPTDNDRHARLEWERAHYHQAVARAYG
VDVDEEPGCVTISADVGLVAPSVQPALRGRLVWTLTDDGVLSLSLRLRRTLGFPSLPRLG
LRLFLPESMSQVDYYGLGPQESYVDKHRASYHGAFSADVVDLHEDYIRPQENGSHADCNK
VLLSGGGLSLAAVGPTPFSFNASRYTQEELAARRRNTELTPSGSTVLCLDAAMAGIGSNS
CGPALRPRYQVDSQELGMELHFLLNPLISHTSTHNEVTL

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	32	931	1.8e-205	0.9747340425531915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09525	lacZ	0.0	5	1030	15	1012	beta-galactosidase.
PRK10340	ebgA	0.0	8	1045	5	1000	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	9.46e-141	44	930	12	804	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	7.83e-101	340	642	1	299	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
smart01038	Bgal_small_N	7.14e-76	785	1044	9	272	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQQ59333.1	0.0	1	1059	1	1059
QCT32124.1	0.0	1	1043	1	1043
QQC21937.1	0.0	1	1059	1	1056
QLF52363.1	0.0	1	1043	1	1043
VEI17476.1	0.0	1	1057	1	1056

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ETZ_A	4.24e-161	47	1035	39	978	Cold-adaptedbeta-D-galactosidase from Arthrobacter sp. 32cB [Arthrobacter sp. 32cB],6H1P_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB - data collected at room temperature [Arthrobacter sp. 32cB]
6SEB_A	7.33e-161	47	1035	60	999	Cold-adaptedbeta-D-galactosidase from Arthrobacter sp. 32cB in complex with IPTG [Arthrobacter sp. 32cB],6SEC_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cBon complex with ONPG [Arthrobacter sp. 32cB],6SED_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB in complex with galactose [Arthrobacter sp. 32cB]
6SE8_A	2.02e-160	47	1035	60	999	Cold-adaptedbeta-D-galactosidase from Arthrobacter sp. 32cB mutant E441Q [Arthrobacter sp. 32cB],6SE9_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB mutant E441Q in complex with lactose bound in shallow mode [Arthrobacter sp. 32cB],6SEA_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB mutant E441Q in complex with lactose bound in deep mode [Arthrobacter sp. 32cB],6ZJS_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB mutant E441Q in complex with galactose [Arthrobacter sp. 32cB],6ZJT_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB mutant E441Q in complex with lactulose [Arthrobacter sp. 32cB],6ZJU_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB mutant E441Q in complex with saccharose [Arthrobacter sp. 32cB]
6ZJP_A	2.02e-160	47	1035	60	999	Cold-adaptedbeta-D-galactosidase from Arthrobacter sp. 32cB mutant E517Q [Arthrobacter sp. 32cB]
6ZJQ_A	2.13e-160	47	1035	62	1001	Cold-adaptedbeta-D-galactosidase from Arthrobacter sp. 32cB mutant E517Q in complex with galactose [Arthrobacter sp. 32cB],6ZJR_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB mutant E517Q in complex with lactulose [Arthrobacter sp. 32cB]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P70753	2.34e-267	1	1048	1	1003	Beta-galactosidase OS=Actinobacillus pleuropneumoniae OX=715 GN=lacZ PE=3 SV=1
O33815	3.09e-228	1	1036	1	985	Beta-galactosidase OS=Staphylococcus xylosus OX=1288 GN=lacZ PE=3 SV=1
P06864	8.45e-172	7	1031	4	986	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4
Q56307	5.11e-159	3	1025	1	962	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
Q2XQU3	1.44e-157	47	1046	56	1029	Beta-galactosidase 2 OS=Enterobacter cloacae OX=550 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002943_02199.