CAZyme Information: MGYG000002943_00588

Basic Information

• Species: Actinomyces oris
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Actinomyces; Actinomyces oris
• CAZyme ID: MGYG000002943_00588
• CAZy Family: GT87
• CAZyme Description: Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
423	MGYG000002943_21|CGC1	46293.33	9.7969

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002943	3026158	MAG	United States	North America

• Gene Location: Start: 370; End: 1641 Strand: -

Full Sequence      

MPAARPPRLVAAARAVASSPVVAVLGWLALLVPAYWSLVDERGQWLFKLDSFVYYEAVRQ
WLDGGDLYSWYANPGQHLWPFTYTPLAAWVISPLTWMSYQQATVLLIVATPLCAAVTAYA
VLRRLAVAPRMARSLAPWLALIGVIALEPFPKTMEYAQVNAILMALVAVDLFLVPERSRW
RGALSGLAAAIKLTPAVAILVLLARREWRAAATMAGSAVGLTLLAALAAPAESWEFFTSA
MWDPGRAGFADYSGNQNLKGAIARGLPEAAWNLTWAVCSLLAVVAAWFLCRRLDRLRGAD
RAAGGTGQDDGLVLSLQISVVMVLGLLISPISWSHHWVWCLPVLMAVAAAAWRWRSTALG
VAVAAGFLVFVLAMQWWFPEQNHVEQNWPAWAKAVGSSYTWWALGCGAVLWWASGRRLKA
LHH

Enzyme Prediction     

No EC number prediction in MGYG000002943_00588.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT87	81	330	4e-58	0.9956709956709957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13375	pimE	4.99e-33	50	362	46	341	mannosyltransferase; Provisional
pfam09594	GT87	1.23e-26	81	330	1	237	Glycosyltransferase family 87. The enzymes in this family are glycosyltransferases. PimE is involved in phosphatidylinositol mannoside (PIM) synthesis, a major class of glycolipids in all mycobacteria. PimE is a polyprenol-phosphate-mannose-dependent mannosyltransferase that transfers the fifth mannose of PIM. The family also includes alpha(1-->3) arabinofuranosyltransferase, invloved in the synthesis of of mycobacterial arabinogalactan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLF52563.1	7.51e-283	1	423	1	423
QQC41072.1	8.93e-275	1	423	1	423
QQQ59548.1	8.54e-273	1	421	1	421
AME00157.1	2.35e-268	9	422	1	414
QCT32348.1	2.04e-248	3	422	32	451

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0R036	4.11e-43	43	417	41	418	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=MSMEG_4247 PE=1 SV=1
P9WMZ8	1.20e-42	43	404	39	396	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2236 PE=3 SV=1
P9WMZ9	1.20e-42	43	404	39	396	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2181 PE=1 SV=1
A0R2K8	2.00e-18	6	345	19	336	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=pimE PE=1 SV=2
P9WN00	5.62e-18	11	345	28	349	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pimE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999837	0.000148	0.000004	0.000000	0.000000	0.000035

TMHMM  Annotations     

start	end
21	39
100	122
134	151
156	175
182	204
268	290
311	333
337	354
359	378
398	415