CAZyme Information: MGYG000002943_00193

Basic Information

• Species: Actinomyces oris
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Actinomyces; Actinomyces oris
• CAZyme ID: MGYG000002943_00193
• CAZy Family: GT0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1069	MGYG000002943_5|CGC1	114453.66	6.8386

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002943	3026158	MAG	United States	North America

• Gene Location: Start: 37660; End: 40869 Strand: -

Full Sequence      

MGGRRLRRLIGAAVRGVHRPRLSVIVRAAGAGPHLEGAIRSVLNQTFRDLEVLVVVGPGA
DALSSGEQVATGLSSRDRRVRVVSCGRDDHRGAGPDGWLDTALKRARGGMVTVVDGGDGL
VGGACQSMIECLEQSGSDVVVARSRSLTPATGAGPGAGPPRAPRLAQPLARVPEAVEELV
AGAVMARRRLWAPPRRPRVLRAPAVSLPARALAVLLAATRMDVLDEEVYTWRAGSAARGL
SADTDPVGLLAEVDALAQLAADAPEAVRRRLVAGRLSRDLVRLAEAAHREGPDFSSRLRR
IARRALADADDLVWEAVGLLDRLVLWLLIQDEPAGAVELEELIGRRCEDLGHLPLTIEAD
TVRPEHALLEGITAPRRLAEIRDVDLRLHVGVDMVRWLGPRTLEVRGCAWVWGLDPGLID
RPTVEVVDETGRVRGRAEADRCEAPRADLEAGDPWRSYLTSGIVVRLQVEAGRPSWFRVV
TRVAGREVRAWMPQPAGSSRRCPAPPETGQHLEARGQRGLLQVAPAPSGIRGSEARPGGE
IDVVLLCARLDTDATLELSGTVAPAPDGLDIVLGGRAAEAQAMTVPAVLGPGDGWSACID
LADPGVELATYPLSWSAVSQDEPDRKVEGACLAGEGIDGPATEAPIAAAATSCVAEPDGD
VTGADAERPARRARILTRTDGSVAVAVIPPLTPGERSRRGHRLLIEREAGPLRPGVFLES
FGGRSGGDNPAAICEDLATHGVGAPLWWSVVDGTVRVPTGARPVVVGSPQWVEALRTSRV
IVTNDHLPSWFSKREGQHLLQTWHGTPIKKLLHDAPRAVTLRYRRLMDRQVPQWDLLLAQ
SPQAGRRLQQALGYRGPVRVGEYPRNVRLLGGAEVRRRVRHELGIAPGQPVILYAPTWRE
SLRPSTGAAGCATVHGPGPVGALDGPRLAELLDAVVLMRSHHMNRAGCVPGMIDVSGYPS
VEELMLAADILVSDYSSIFFDFALTGKPAVVYAPDLASYRDVERGLYGDWPLGSGLPVAA
DHDELASHLQRLLGDIDVAEGRYSPLEVEPAPILDNLTWIRGWIARFLS

Enzyme Prediction     

No EC number prediction in MGYG000002943_00193.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	5.72e-68	711	1045	1	337	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	3.48e-38	713	1050	26	365	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].
cd00761	Glyco_tranf_GTA_type	1.11e-06	24	108	1	78	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG0463	WcaA	5.84e-06	18	111	1	87	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00535	Glycos_transf_2	1.24e-04	23	108	1	79	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLF53050.1	0.0	1	1069	1	1070
QQQ60003.1	0.0	1	1069	1	1069
QQC38725.1	0.0	1	1069	1	1069
AMD98146.1	0.0	1	1069	1	1069
QCT32820.1	0.0	1	1069	1	1065

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	6.88e-32	716	1032	355	680	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7M_A	3.71e-31	716	1032	355	680	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7J_A	4.92e-31	716	1032	355	680	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8RKI5	3.23e-32	716	1010	34	338	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
Q2G1C1	1.32e-31	716	1032	30	353	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
Q5HLM5	3.62e-31	716	1032	355	680	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
P13485	4.07e-31	713	1032	381	708	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q2G1B8	1.40e-10	874	999	373	497	Teichoic acid ribitol-phosphate polymerase TarL OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002943_00193.