CAZyme Information: MGYG000002939_01167

Basic Information

• Species: Enterococcus_A sp002140655
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_A; Enterococcus_A sp002140655
• CAZyme ID: MGYG000002939_01167
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
253		29388.3	10.1115

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002939	2985142	MAG	Russia	Europe

• Gene Location: Start: 5; End: 766 Strand: +

Full Sequence      

MYKRQNLEIVTSQRIIHTGMWQLFKIGQIPGTNFIIQTQLIKELGGWDNGALTEDTALSF
RIMKLGKLIALASRAEAFQQEPETLAVYYRQRKRWAKGNYEVILNNMKDIFGGSNWRIRL
QSIYYFNTFFWFTSAIILSNIMFIANLIAMILHIWIPSIDVIFTFGGSNRQIGALLLVNW
ALMFAIYLLQIQLALSSQFGQATTANFFYAIASYFTYSLLFIGISIMSLFSYIGDKIFRR
DSSKWYKTQRFDD

Enzyme Prediction     

No EC number prediction in MGYG000002939_01167.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	29	158	2.1e-16	0.5989847715736041

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	2.98e-17	3	177	188	370	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam13632	Glyco_trans_2_3	7.87e-13	29	159	72	188	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
PRK11204	PRK11204	1.20e-12	41	243	221	407	N-glycosyltransferase; Provisional
cd06421	CESA_CelA_like	3.38e-12	31	103	162	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
PRK14583	hmsR	9.23e-10	43	250	244	437	poly-beta-1,6 N-acetyl-D-glucosamine synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBM16591.1	5.55e-164	6	253	59	306
QXJ60715.1	7.91e-162	6	253	190	437
QZO08782.1	1.65e-161	6	253	191	438
AXG39324.1	2.26e-161	6	253	190	437
QCQ14859.1	1.65e-156	6	252	190	436

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	3.74e-46	6	252	187	415	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q8GLC5	6.41e-08	26	106	198	278	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1
Q5HKQ0	6.41e-08	26	106	198	278	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaA PE=1 SV=1
Q99QX3	2.09e-07	3	106	175	278	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=icaA PE=3 SV=1
Q8NUI7	2.09e-07	3	106	175	278	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
123	145
149	167
174	196
211	233