CAZyme Information: MGYG000002938_02040

Basic Information

• Species: Clostridium_B sp902809985
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_B; Clostridium_B sp902809985
• CAZyme ID: MGYG000002938_02040
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
189	MGYG000002938_468|CGC1	20718.22	4.8941

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002938	2518779	MAG	Russia	Europe

• Gene Location: Start: 56; End: 625 Strand: +

Full Sequence      

MSLERILAANPGINPYYLRVGQIICIPACLPNYTPRIIRPGDTLYKIAREYNVSVESILD
ANPGVDPNYLRVGQRLCIPSGNGGSSNCGETVTAMQEDIDMLIPESSVQQTHESNYGDST
QTTSVIMVNSGQIRFDAVPVNIFGDYVGHYTEGKNYPYYADAASGGQRGINVKDNFGVWH
SFGYRVPVT

Enzyme Prediction     

No EC number prediction in MGYG000002938_02040.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	37	79	7.7e-16	0.95

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00257	LysM	1.66e-14	37	78	3	44	Lysin motif.
cd00118	LysM	2.55e-14	37	78	4	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01476	LysM	2.95e-13	37	79	2	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
COG1388	LysM	2.58e-07	31	87	64	118	LysM repeat [Cell wall/membrane/envelope biogenesis].
COG3858	YaaH	9.10e-06	20	80	39	96	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APM39550.1	1.44e-104	1	189	33	221
EDK34832.1	4.65e-92	1	188	33	221
AEE95526.1	2.24e-26	1	79	94	176
SHD78284.1	8.45e-24	1	79	150	234
QAT63505.1	3.15e-23	1	88	74	162

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B8V_A	6.54e-08	1	95	134	227	ChainA, Extracellular Protein 6 [Fulvia fulva],4B9H_A Chain A, Extracellular Protein 6 [Fulvia fulva]
5BUM_A	2.30e-06	28	78	1	48	CrystalStructure of LysM domain from Equisetum arvense chitinase A [Equisetum arvense],5BUM_B Crystal Structure of LysM domain from Equisetum arvense chitinase A [Equisetum arvense]
5K2L_A	8.35e-06	38	79	7	48	Crystalstructure of LysM domain from Volvox carteri chitinase [Volvox carteri f. nagariensis],5YZK_A Solution structure of LysM domain from a chitinase derived from Volvox carteri [Volvox carteri f. nagariensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05495	9.25e-06	2	80	22	94	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000081	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002938_02040.