CAZyme Information: MGYG000002935_02045

Basic Information

• Species: Phocaeicola sp002161765
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp002161765
• CAZyme ID: MGYG000002935_02045
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
789		89648.59	5.5759

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002935	2727252	MAG	Finland	Europe

• Gene Location: Start: 9490; End: 11859 Strand: -

Full Sequence      

MKKKTLMLMACLACLGSTQAQEKLYPNSFPLSEVTLLDGPFKHAQEVNGKVLLEYDVDRL
LAPFLKEAGLPKKAELFPNWEGLDGHVGGHYLSALAIHYAATGNEECKRRMEYMIAELKR
CQEKNGDGYIGGVPNGKPLWEEIKKGNVGAIWKYWVPWYNQHKLYAGLRDAWMYAGNEEA
RQMFLDLCDWGIEVISPLTDEQMEQMLEMEFGGMDEVYADAYQMTGDKKYLDAAKRFSHH
WLLDSMAKGVDNLDNKHANTQVPKAVGYQRIAELGNDPTYEDAATFFWHTVVENRSLSFG
GNSRREHFVAKNDSKSYVEDREGPETCNTNNMLKLTEGLFRMHPEASYADFYERALYNHI
LSAVHPEHGGYVYFTSARPAHYRVYSAPNQAMWCCVGTGMENPGKYGEFIYTHTGDSLFV
NLFIASRLEWKEGGIKLTQETQFPAEEGSRITVSLDAPKRFKVLVRHPSWVKTGEMQTIC
GGKNYAEGSKASSYVCIDREWKNGDVIEIRTPMRVTLEEFPNLPEYVAILRGPIVLGARM
GTENLDGLVADDSRWGHIASGPLVPVYDTPFLIGEREEILAKLEEMKPVEGKPLHYTVSG
LFRSDKYKDLELEPFYGIHDSRYSIYWLSMDEAGYDRYLKERKAEEEARIALDRRTVDAI
APGEQQPEADHLMKSENSTKGNFEGRAWRDAKDGGYFSYVLSTEGKSGLTLRITYWGNET
ADREFDILINNQLLASENLVGKWKKQAFVDVEYPIPADMLKGKKEVTLTFRPKPGKIAGG
VFYIRLTEE

Enzyme Prediction     

EC	3.2.1.185

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	33	536	8.7e-199	0.9960238568588469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.65e-176	33	536	1	502	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.59e-108	31	541	9	505	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	4.75e-41	541	627	1	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36520.1	0.0	12	788	14	786
ADY37333.1	0.0	1	789	1	797
SCV06553.1	0.0	5	789	8	798
QRQ58640.1	0.0	5	789	8	798
ALJ47143.1	0.0	5	789	8	798

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	2.23e-228	3	788	2	802	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	1.34e-221	3	788	2	802	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	1.65e-19	222	535	203	543	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	2.87e-19	91	571	82	625	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	4.64e-18	271	571	279	625	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000917	0.827397	0.170600	0.000431	0.000350	0.000286

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002935_02045.