CAZyme Information: MGYG000002935_01581

Basic Information

• Species: Phocaeicola sp002161765
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp002161765
• CAZyme ID: MGYG000002935_01581
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324		37076.33	8.8361

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002935	2727252	MAG	Finland	Europe

• Gene Location: Start: 19060; End: 20034 Strand: +

Full Sequence      

MKTFFTQFIRTGLPGAAFFLSLAAFTLSLSAQTAEDSSTPAPAYSCIEVPASMTFCGETI
DLTRFDRRERMDRELLAFTYMHSTTIQLIKRANRYFPIVESILRENGVPDDFKYLMSIES
NNNPLARSVAGAAGLWQFMPATGREFGLEVGNSVDERYHVEKATRAACKYLKQAYARFGN
WVSVAASYNAGQGRISRELERQYEENALDLQLVEETSRYVYRILAVKMLFADPAKFGFHL
RASDLYPPIPYREIKVEKTIEDLPRFAKGQGITYALLRNMNPWLRSRSLHVHGSKVYYLR
IPDTESMHYNPQVIFPHDSNWVKP

Enzyme Prediction     

No EC number prediction in MGYG000002935_01581.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	95	226	7.9e-26	0.8740740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	4.74e-62	103	228	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	5.70e-25	98	204	1	108	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	6.35e-23	115	225	7	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK10783	mltD	1.42e-22	68	244	81	258	membrane-bound lytic murein transglycosylase D; Provisional
cd13401	Slt70-like	1.67e-18	95	225	6	144	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY36030.1	1.70e-213	1	324	1	324
QRO24006.1	1.15e-155	44	322	42	320
QEW35083.1	9.09e-141	35	322	43	330
QQY44628.1	9.09e-141	35	322	43	330
QQY40386.1	3.68e-140	35	322	43	330

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FCQ_A	1.71e-07	126	232	481	594	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FBT_A	1.71e-07	126	232	481	594	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
6FC4_A	1.71e-07	126	232	482	595	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	1.74e-07	126	232	510	623	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
7EYB_I	8.60e-07	106	226	23	145	ChainI, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7EYB_J Chain J, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7EYB_K Chain K, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7EYB_L Chain L, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_B Chain B, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_D Chain D, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_F Chain F, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_G Chain G, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_J Chain J, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_L Chain L, Peptidoglycan transglycosylase gp16 [Escherichia phage T7]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	6.59e-22	68	302	78	308	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	6.59e-22	68	302	78	308	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
P03726	4.71e-06	106	226	23	145	Peptidoglycan transglycosylase gp16 OS=Escherichia phage T7 OX=10760 GN=16 PE=1 SV=1
O31976	8.81e-06	119	225	1447	1539	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	8.81e-06	119	225	1447	1539	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003723	0.995362	0.000266	0.000230	0.000188	0.000192

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002935_01581.