CAZyme Information: MGYG000002933_00835

Basic Information

• Species: Phocaeicola sp900540105
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900540105
• CAZyme ID: MGYG000002933_00835
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	MGYG000002933_9|CGC3	42253.18	4.3884

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002933	3120707	MAG	Estonia	Europe

• Gene Location: Start: 79778; End: 80899 Strand: +

Full Sequence      

MKYRLLFFFITGLLLASCSKIEDEYVYDTGYVIDWSAAADSASSTLPDRFWNEEGYFNYE
NDGNGTGFQYWPQAQAMDVVIDAYLRSGDTKYSDLFTPWYEGIRVKNGNSYWNNFYDDME
WIGLTMVRLYETTQEEKYLNTAKELWGYIEGGWDEEYGGGGVSWKADQRWSKNACSNGPA
ALLAMRLYAVTQDETYKDWGVKIYTWLRENLFNKATGAVYDNLNGETGEIGGFSLSYNQG
TFLGAAHELYKVTGEANYLKDARKAAYFCISDAGMIDSGNNVLRDEGTGDGGFFKGIFMR
YFVKLIMEPDLDEVYRKKFVTFFNNNADVLWRKGVNKLDILFGTNWTTPASGTTELGAQA
SGCALIEAKALLK

Enzyme Prediction     

No EC number prediction in MGYG000002933_00835.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	41	358	4.8e-90	0.8994413407821229

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03663	Glyco_hydro_76	1.62e-51	54	363	18	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG4833	COG4833	5.83e-38	68	361	43	338	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
cd04791	LanC_SerThrkinase	5.56e-04	122	266	91	231	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.
COG1331	YyaL	0.002	141	294	184	317	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
cd04792	LanM-like	0.004	122	266	499	621	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA30005.1	5.37e-187	13	373	13	373
BBK86488.1	5.37e-187	13	373	13	373
QUT65780.1	5.37e-187	13	373	13	373
QMI79910.1	5.37e-187	13	373	13	373
QBJ18505.1	5.37e-187	13	373	13	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	1.60e-87	32	373	51	390	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	5.21e-86	32	373	52	391	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	4.14e-85	32	373	52	391	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
3K7X_A	9.64e-44	35	373	3	341	ChainA, Lin0763 protein [Listeria innocua]
4BOK_A	6.76e-40	40	361	8	333	ChainA, Alpha-1,6-mannanase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O74556	6.44e-09	36	253	27	263	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000028	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002933_00835.