CAZyme Information: MGYG000002922_00931

Basic Information

• Species: RC9 sp900541925
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900541925
• CAZyme ID: MGYG000002922_00931
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394		45212.47	4.7863

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002922	2264361	MAG	United States	North America

• Gene Location: Start: 48673; End: 49857 Strand: -

Full Sequence      

MNRLIPAILAMAALVSCADKTEPMSEKMVRSQMSRCPEPTYLDYLNGKLKWGYTPGLELK
AFLDVYDTYGGQDIYDYVHLWYDDVVNADGTIKTYSVEKYNVDLICPGRSLFYFYDKTGE
EKYRKAIELIKTQIDAQPRTSEGAFWHKQIYPHQIWLDGVYMAEPFYAEYAKRYMSGEEQ
AEAYKEIVNEFITAAKHTYDPATGLYRHAWDESRSMFWCDPQTGQSQHCWGRALGWYCMA
IVEVLDYLPENLAERQSLIDLLKSICAELPKWADPVSGVWYQVLDQPGREGNYLEATCSA
MFSYTFLKGIRMGYLDKDLLPYAKKVYEDVVKEFISTDGQGLISLEKCCSVGGLGGDGRR
MGDFAYYLSEPVRPNDSKGVGPFIWASLEMERLK

Enzyme Prediction     

No EC number prediction in MGYG000002922_00931.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	48	392	2.9e-120	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.09e-107	25	394	2	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	3.67e-90	24	393	11	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK63671.1	1.03e-147	2	392	3	398
QDO69177.1	1.27e-142	1	394	2	397
QUT93209.1	2.55e-142	1	394	2	397
ALJ61262.1	2.55e-142	1	394	2	397
QUT77882.1	2.16e-139	23	394	31	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.58e-105	51	393	23	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.37e-64	50	393	38	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	5.76e-64	50	393	28	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	7.65e-21	51	340	65	337	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	5.47e-19	51	340	66	338	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	7.49e-64	50	393	38	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	5.42e-33	162	389	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	5.42e-33	162	389	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000137	0.167337	0.832379	0.000056	0.000066	0.000054

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002922_00931.