CAZyme Information: MGYG000002909_00069

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Gemellaceae; Gemella
• CAZyme ID: MGYG000002909_00069
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
852	MGYG000002909_1|CGC3	94859.94	9.6462

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002909	1190953	MAG	United States	North America

• Gene Location: Start: 76324; End: 78882 Strand: -

Full Sequence      

MAENNNSRLSRRDRHSQERKSVMPGGYISRGNNNPTNNGQQRRPLTNEEVMRRNAQNAGP
SNQQQRAGNANQGQGVPPVRPRNAQQSARTGKPGGPRRPLGPNRISNPNSKKSNKTLWMK
ILRYGLYAASVAIISLFLLCVFWIYQAPAFDSKILDNNSRTIVYDVNNNEVAKLGNQIGE
NLNTSDIPTKMQDAILATEDNRFFEHGAVDFRRLVGAVFSNLTSGFGSQGASTISQQLIK
RTFLDDNKSMKRKVQEAYLAYKLEQNYDKESIFTMYVNRIYYSDGVYGLKTASKYYFGKE
LNQLTLSQMALLAGLPQHPNTYNPYDNPEAAKARRDTVLYLMQYHGKISEAESTAAQKTN
VLDGLIERDESERVLLSSEFDSKYTSYMNQIVNELKNSKEFKDYEGDVLNLGLKIYTNFD
SKIQDTLTESVNANYAGIKQASNVAMVVLNNENSGIAALYGGKKQTFHGFNIATQAKLQP
GSSIKPILAYGPAVEYLNWGSDHTVNDSKIQGSQIQNWDRQFHGNITINNALVWSYNIPA
IKTYQEVGFDRVKQYANNVGMDIKDNSITTPIGGSGDGFSPLQMAGAYVPFSNGGYYATP
KAIKKVYDSEGSEVKSFSKDDRKRVIKESTAYIMTSMLRNVVNGTASFARISGADMAVKT
GTTTFGEGEAQKYNFDIDNYSKDSWTIGYTSNYTMAVWQGFDAIDGPTKYMTQEDTQKTQ
ALYRINMQNIVRIHPPKGFKVPENVGSINGGVKVISDSERREIEEQNKRNQEEKDKDKDR
NNNNNNGNNSNDDNNRNGNNSEDNNSNLSNQNGQQNGNNGNSQSRGGNSNGVQPGVRNSG
ANNNNNASRGNR

Enzyme Prediction     

No EC number prediction in MGYG000002909_00069.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	169	343	7.9e-63	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0744	MrcB	1.46e-176	107	767	2	633	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	3.74e-170	179	712	2	512	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	7.59e-105	118	749	1	737	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
TIGR02071	PBP_1b	2.10e-89	185	745	153	695	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam00912	Transgly	1.22e-76	167	343	1	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX87519.1	0.0	1	852	1	850
VEI39074.1	0.0	1	764	1	767
QGS09844.1	0.0	1	769	1	757
SQH55781.1	0.0	1	765	1	753
AXI26857.1	0.0	1	770	1	759

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DWK_A	1.48e-145	163	768	10	622	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	2.91e-141	146	768	2	631	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
3ZG8_B	7.25e-64	262	705	2	436	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3ZG7_B	3.08e-57	262	705	2	436	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
3UDF_A	3.13e-54	163	702	23	689	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39793	2.61e-125	103	745	15	656	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
Q00573	5.28e-106	114	701	2	600	Penicillin-binding protein 1A (Fragment) OS=Streptococcus oralis OX=1303 GN=ponA PE=3 SV=1
Q04707	3.67e-101	114	745	2	640	Penicillin-binding protein 1A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=ponA PE=1 SV=2
Q8DR59	1.94e-100	114	745	2	640	Penicillin-binding protein 1A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pbpA PE=1 SV=1
P38050	1.01e-95	151	705	39	574	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
124	146