CAZyme Information: MGYG000002905_00420

Basic Information

• Species: CAG-279 sp900541935
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-279; CAG-279 sp900541935
• CAZyme ID: MGYG000002905_00420
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
342		38657.98	9.4851

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002905	2448974	MAG	China	Asia

• Gene Location: Start: 597; End: 1625 Strand: -

Full Sequence      

MEASAGVPPIIHYKKMAYMAFSEVLRHLPQILGNMKATKKAIDEFEPDALILIDYPSFNL
KIAKYAHSKGIKTYYYISPKVWAWKEYRVKDIKKYINKVFSILPFETEFYKRHNYQVDYV
GNPTANEIAEARRHFLSFEEILQRAGTADRRPIIALLPGSRVGEIRNNLPIMYQAAARFA
NFQPVIASAPNIDKEFYAEALKAKGINAKPVMIEGNTFDLVAQSAVALVTSGTATLETAI
IGTPQIVCYRANGSKLAYKLFEKILKVKYVSLPNLIADEEVVKEMLLHLCTPDAIAKELE
PLLYDSPQWRKMDAGYRKISERLGTNDSAETAAKEIVKDLLK

Enzyme Prediction     

No EC number prediction in MGYG000002905_00420.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	323	4.9e-101	0.8813559322033898

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.24e-101	1	342	41	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.65e-98	1	342	41	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	5.00e-73	1	336	38	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.40e-61	3	337	46	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	3.00e-46	8	336	40	344	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36425.1	3.16e-124	1	340	40	374
QQR08529.1	2.49e-122	1	333	40	367
ASB37800.1	2.49e-122	1	333	40	367
ANU64105.1	2.49e-122	1	333	40	367
BCI64292.1	3.58e-112	12	342	50	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	2.21e-34	40	332	84	374	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	5.93e-34	40	332	84	374	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	2.74e-61	3	337	45	375	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q3JAC1	9.30e-56	4	324	47	363	Lipid-A-disaccharide synthase OS=Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107) OX=323261 GN=lpxB PE=3 SV=1
Q1INL4	4.51e-55	4	341	44	375	Lipid-A-disaccharide synthase OS=Koribacter versatilis (strain Ellin345) OX=204669 GN=lpxB PE=3 SV=1
Q39T49	3.65e-54	4	342	48	382	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q74AT9	7.21e-54	5	342	49	382	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002905_00420.