CAZyme Information: MGYG000002902_00355

Basic Information

• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Veillonellaceae; F0422
• CAZyme ID: MGYG000002902_00355
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
535		61596.45	7.5441

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002902	1044038	MAG	United States	North America

• Gene Location: Start: 314; End: 1921 Strand: -

Full Sequence      

MQETFSWKRLAWLGIGTFLFYLWMAWALPITDTVESNYALSAVTMIQHGEFLSPMIYDVY
WFDKPIVAYWGLILSYSLFGISDLAARLPSIFISTCTVLAMYRMAFSIYQVERVAMWSAI
ALGTALEFWYIGHAVVTDGYLFLFSLGIFYYVYRGITGESHRHMVYAYLFAGLAVLTKGP
VGIVLPGIILILYVALNRRMDWFKYVFSWKGILAFLIVVAPWYGYMYQVHGAAFVDGFLG
LHNVTRAIVPEHPEHNWWYLYFALLPICMMPWTSFVLRGVNEQKHAYIWYWSIFWFVGTI
VFYTCMATKYITYTFIMLIPLSLWAGMGVHACIETYKENTMTWNVFVLYALGGFPFLLGI
VLALLTVPAFHTLYIWGSLLVLVICIVYAAFRRTGHVLVCSMATSAIVFYLALVPTLEPV
IESQSGKQLATEVTEIEGSTPLEVYQYGNYRTSLSYYLGRTTSYIHYKEHESVWEDGKNI
MPMVKPTDLEQDPEKLSRALIYVPIKYAIYFKETSLYDHLQLVKKSSNGAFFKVK

Enzyme Prediction     

No EC number prediction in MGYG000002902_00355.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	4	472	9.5e-84	0.8962962962962963

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	7.48e-35	6	365	6	372	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	1.30e-16	63	222	1	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
PRK13279	arnT	2.18e-11	35	387	33	390	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam02366	PMT	1.79e-06	32	228	29	236	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG0474	MgtA	0.005	288	391	773	872	Magnesium-transporting ATPase (P-type) [Inorganic ion transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNV73216.1	1.10e-110	28	535	27	538
VEG94157.1	2.13e-107	28	535	27	538
BBU36964.1	1.32e-105	28	535	27	538
QQB17357.1	1.65e-105	28	535	27	546
SNV00837.1	1.65e-105	28	535	27	546

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	7.63e-10	35	274	59	301	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67601	4.39e-17	8	309	3	287	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
Q7N3Q9	1.05e-15	15	374	9	378	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=arnT PE=2 SV=1
A0KGY4	2.41e-15	20	374	15	372	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
O67270	2.78e-15	35	460	30	437	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
B7VBN0	3.21e-15	35	337	32	336	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain LESB58) OX=557722 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000003	0.000001	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
9	31
59	81
88	110
114	133
140	157
172	194
207	229
258	280
287	306
311	333
345	367
372	391
398	417