CAZyme Information: MGYG000002885_00713

Basic Information

• Species: Pseudomonas_E juntendi
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_E; Pseudomonas_E juntendi
• CAZyme ID: MGYG000002885_00713
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318	MGYG000002885_54|CGC1	36937.52	9.2257

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002885	3148284	MAG	United States	North America

• Gene Location: Start: 2834; End: 3790 Strand: +

Full Sequence      

MKVLFLVQKEQRAILDRLYDGVAANCECDLRWLTSEDQRNLRRYFKRHVQVERYDRIVFF
LRFKQEIRQVAFIRTVPNLVILEHDAYQNYIPCKYTGKFSAHYRQLLWARVISSGYMVSE
RLRQEGFDAVFVPKGYDEQLLADQGRERDIELAFVGSVNSVAYSGRKALLDELGQVEDLL
VTRTKSGEDYCNTLNRIRFFVSADVGMGEYMIKNFEAMACGCVLLAYDQGEQENRALGLQ
DMHNVVLYDTIPTLQAKLRRLRAEPELARQIAENGRHLAVSRFSFGAVGRSIVEHMRPAL
RPRPPLSAWQRLRLKLGF

Enzyme Prediction     

No EC number prediction in MGYG000002885_00713.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13524	Glyco_trans_1_2	3.91e-08	212	294	14	93	Glycosyl transferases group 1.
COG0438	RfaB	3.63e-06	32	303	116	381	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03801	GT4_PimA-like	2.37e-05	216	297	286	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03800	GT4_sucrose_synthase	0.008	216	284	321	388	sucrose-phosphate synthase and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. The sucrose-phosphate synthases in this family may be unique to plants and photosynthetic bacteria. This enzyme catalyzes the synthesis of sucrose 6-phosphate from fructose 6-phosphate and uridine 5'-diphosphate-glucose, a key regulatory step of sucrose metabolism. The activity of this enzyme is regulated by phosphorylation and moderated by the concentration of various metabolites and light.
cd01635	Glycosyltransferase_GTB-type	0.009	39	228	40	218	glycosyltransferase family 1 and related proteins with GTB topology. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDR70365.1	1.29e-230	1	318	1	318
QEQ89985.1	1.29e-230	1	318	1	318
QKL04133.1	5.24e-230	1	318	1	318
QOH71873.1	2.13e-229	1	318	1	318
AOX11369.1	1.09e-222	1	318	1	318

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002885_00713.