CAZyme Information: MGYG000002884_01599

Basic Information

• Species: UMGS951 sp900547155
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; UMGS951; UMGS951 sp900547155
• CAZyme ID: MGYG000002884_01599
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
209	MGYG000002884_25|CGC1	22947.76	9.8929

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002884	2277749	MAG	Ireland	Europe

• Gene Location: Start: 13439; End: 14068 Strand: +

Full Sequence      

MIRKLLTITLLFNLCMFANPEQSQAAPASKMTVKEYIVKHSLEMGVDPALGLSIAKMESG
FVHEKKSPYGAVGVFQLLPSTAKRIGYNPYSLSGNIQGGLAYYKMMYQKFGSVELALAAY
NAGPGNVAKYKGMPPFAETKKFVRNIMSEYNMQKANPDPAITKFQKQKAQTVPANNTAVT
VDKSENVIKQVRSESAELDLPIMPLTEAI

Enzyme Prediction     

No EC number prediction in MGYG000002884_01599.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	42	155	2.1e-23	0.8592592592592593

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	3.16e-31	34	152	5	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	1.73e-30	48	151	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	4.33e-29	34	148	7	144	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd13403	MLTF-like	1.80e-21	37	151	1	157	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	3.83e-21	45	142	9	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39353.1	1.85e-61	3	166	2	162
QNF30947.1	8.51e-31	32	152	27	149
QTL50230.1	7.10e-30	21	150	96	227
AIF43250.1	8.14e-30	20	150	74	206
QHG09922.1	9.08e-30	25	151	94	221

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.18e-11	34	148	417	550	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	1.18e-11	34	148	421	554	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O29_A	1.19e-11	34	148	437	570	Lytictransglycosylase in action [Neisseria meningitidis]
5O24_A	1.19e-11	34	148	431	564	Lytictransglycosylase in action [Neisseria meningitidis]
6FPN_B	1.19e-11	34	148	427	560	Lytictransglycosylase in action [Neisseria meningitidis MC58]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	8.74e-27	18	150	45	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	3.17e-26	36	164	1425	1555	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	3.17e-26	36	164	1425	1555	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P27380	2.71e-10	35	162	9	131	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
P0AGC3	4.09e-10	46	148	493	620	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000211	0.999025	0.000265	0.000171	0.000158	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002884_01599.