CAZyme Information: MGYG000002883_00751

Basic Information

• Species: UMGS1477 sp900553845
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; UMGS1477; UMGS1477 sp900553845
• CAZyme ID: MGYG000002883_00751
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382		44905.62	9.7583

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002883	1791873	MAG	Ireland	Europe

• Gene Location: Start: 1425; End: 2573 Strand: -

Full Sequence      

MKKKKIFIITGELSGDLHSSYVVKELKKLCDNVEIEAIGSNNLENQGVKLFEDHKKMSAV
GLSFNILFNHIKLGKNLINYLKNDYKPDLVLLIDYGGFNLNMAKFLKKEEFTIFYYIPPQ
IWASRSYRINTIKKYVDKVLTIFPFENEIYEKKGIDVKYTGHPLIYEIPQIDETKEDFFA
RHNLEKHKKLVSIFPGSRKFELKQLFKIFIDAKKIIEESEKGNVQFVLSQANNIEDKLFN
YYTKKYIKEKDIKIIKGENYHILKYSDALMLASGTVALEAALYKTPFLVAYRGPWLFYLI
YLFVRSIKMVSLPNIILNKRIIKEMIQNKCNKKQIANEILKILNDNNYREHMIYNLNQVK
DMLSHKNSSYEAAKCIYETLYP

Enzyme Prediction     

No EC number prediction in MGYG000002883_00751.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	6	363	1.8e-103	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	3.85e-98	4	353	2	349	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.97e-92	4	380	2	379	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	7.44e-66	6	376	1	370	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.09e-57	6	345	8	347	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.16e-36	4	378	2	346	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39331.1	2.24e-137	4	381	2	373
SNV49777.1	3.08e-71	5	380	2	369
AIH02795.1	6.07e-70	5	376	2	363
QDE19675.1	6.07e-70	5	376	2	363
QLE00659.1	9.59e-70	5	380	2	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.03e-35	6	378	9	379	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.03e-35	6	378	9	379	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B6J161	9.42e-66	1	381	1	375	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
A9KC41	1.33e-65	1	381	1	375	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1
B6J9H1	1.87e-65	1	381	1	375	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuK_Q154) OX=434924 GN=lpxB PE=3 SV=1
Q83DS5	1.03e-64	1	381	1	375	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=lpxB PE=3 SV=1
A9NCA7	1.03e-64	1	381	1	375	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) OX=360115 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
295	317