CAZyme Information: MGYG000002873_00948

Basic Information

• Species: CAG-495 sp900538765
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-239; CAG-495; CAG-495 sp900538765
• CAZyme ID: MGYG000002873_00948
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372	MGYG000002873_10|CGC1	40435.87	9.876

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002873	1867269	MAG	United States	North America

• Gene Location: Start: 43533; End: 44651 Strand: +

Full Sequence      

MKSTEKDTRPLIILTAGGTGGHVYPADALAAELEQRGYRLALVTDSRGKDNYKGKLAEIP
NYAVLAGGLVGKGKWTKIKNLFKICIGILQAGVILFRQKPVCVVGFGGYASFPCAMAAIL
LGIDLVIHEQNSVMSRTNRFLSKYAELIAQSFRNVKYTPPAARTVLTGMPVRQAIASVRE
QPRPETASGKFRLLILGGSQGAKIFGDIIPEAVKQLDKKLQKNLTVCQQCRRDDVEKLRE
AYQDCPADTTISHFFNNMPELYAASHLIISRSGASSVCEIAAVGIPSILVPLPTAADDHQ
TGNARELSENGGAILIKQADFTAERLSQTLTELFTHPKQLEKMATQSRKAGITNAAALFA
DAIEKQIIRKQK

Enzyme Prediction     

No EC number prediction in MGYG000002873_00948.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	193	354	1.2e-50	0.9808917197452229

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	1.35e-147	12	367	4	355	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	4.32e-133	12	361	2	349	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	7.98e-118	12	369	3	357	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	1.29e-108	12	363	3	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam04101	Glyco_tran_28_C	7.50e-46	193	359	2	166	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIM10292.1	1.61e-155	1	369	1	368
BAE52652.1	3.19e-103	3	363	2	361
CUW38580.1	6.38e-103	9	363	5	361
CDK99712.1	9.97e-102	8	363	2	359
ARJ66991.1	1.03e-101	11	363	7	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	2.06e-65	1	365	1	364	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
3S2U_A	8.93e-64	12	362	5	350	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	3.75e-42	12	365	9	352	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2W0H3	6.37e-104	3	363	2	361	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) OX=342108 GN=murG PE=3 SV=1
Q2RVU4	5.29e-93	12	363	19	369	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1) OX=269796 GN=murG PE=3 SV=1
B6IRG2	2.99e-90	12	363	6	358	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) OX=414684 GN=murG PE=3 SV=1
Q2IYK8	8.17e-87	10	365	5	362	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Rhodopseudomonas palustris (strain HaA2) OX=316058 GN=murG PE=3 SV=1
Q5FUJ5	8.94e-86	9	364	3	360	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Gluconobacter oxydans (strain 621H) OX=290633 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
101	123