CAZyme Information: MGYG000002872_01917

Basic Information

• Species: UMGS874 sp900546315
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS874; UMGS874 sp900546315
• CAZyme ID: MGYG000002872_01917
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
507		57795.82	4.9398

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002872	3007809	MAG	United States	North America

• Gene Location: Start: 12507; End: 14030 Strand: +

Full Sequence      

MKVTMLENEVWYGLAVSEGTKMPVGKDDNFSFAMQPVNTNNQYSPLLLSNKGRYIRGEYA
FYTKISDAVIEVTSKLRQAELYEGYTDLRGAFRAAEEAHFPADGKLPPEEFFSKPQYNTW
IELIYNQNQKDITEYCRHIVENDMPKGVIMIDDLWTPYYGSWEFDRVKFPDPKGMIDLLH
EWGFRVMLWICPFVSPDSFEFRYLRDKGGLVRNPDGKVRIVGWWNGFSGVLDLSNPVDIE
WFRSRCGHLTEDYGVDGFKFDAGDACFYRPDDKTAGNVTPNEQCRLWADIGLGYPYNEYR
ACYRNAGRPLVQRLQDKSHSWTGHGINELIPNMLAQGILGYSYGCPDMVGGGSFTDFLPG
STKFDPELFVRYCATAALMPMIQFSAAPWRVLDDEHYAMILGLMKLREEFLPTILELVKN
SAKTGEPAVRYMEYVFPGQGFEKVIDQFCLGDDIIVAPVLTKGAVTRDIALPDGKWKDHR
TGKIYDGGKTITVDAPVDSLPIMERVR

Enzyme Prediction     

No EC number prediction in MGYG000002872_01917.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	118	503	4.1e-80	0.9086651053864169

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06592	GH31_NET37	1.13e-168	113	476	1	364	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG1501	YicI	5.08e-61	79	505	245	665	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
pfam01055	Glyco_hydro_31	1.19e-57	127	502	40	434	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
PRK10426	PRK10426	3.18e-34	162	505	261	618	alpha-glucosidase; Provisional
cd06603	GH31_GANC_GANAB_alpha	3.23e-30	125	507	20	433	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATD49216.1	4.76e-188	5	506	11	511
AQW26139.1	4.76e-188	5	506	11	511
AMN32313.1	4.76e-188	5	506	11	511
ABG83900.1	4.77e-188	5	506	1	501
SQI03748.1	1.92e-187	5	506	11	511

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F7S_A	3.66e-32	153	506	358	729	Cycloalternan-degradingenzyme from Trueperella pyogenes [Trueperella pyogenes],5F7S_B Cycloalternan-degrading enzyme from Trueperella pyogenes [Trueperella pyogenes],5I0E_B Cycloalternan-degrading enzyme from Trueperella pyogenes in complex with isomaltose [Trueperella pyogenes],5I0F_B Cycloalternan-degrading enzyme from Trueperella pyogenes in complex with covalent intermediate [Trueperella pyogenes]
5I0G_B	3.88e-31	153	506	358	729	Cycloalternan-degradingenzyme from Trueperella pyogenes in complex with cycloalternan [Trueperella pyogenes]
5F7U_A	2.36e-30	168	505	435	797	Cycloalternan-formingenzyme from Listeria monocytogenes in complex with pentasaccharide substrate [Listeria monocytogenes EGD-e]
5I0D_A	7.95e-28	168	505	435	797	Cycloalternan-formingenzyme from Listeria monocytogenes in complex with cycloalternan [Listeria monocytogenes EGD-e],5I0D_B Cycloalternan-forming enzyme from Listeria monocytogenes in complex with cycloalternan [Listeria monocytogenes EGD-e]
4KMQ_A	8.04e-28	168	505	456	818	1.9Angstrom resolution crystal structure of uncharacterized protein lmo2446 from Listeria monocytogenes EGD-e [Listeria monocytogenes EGD-e],4KWU_A 1.9 Angstrom resolution crystal structure of uncharacterized protein lmo2446 from Listeria monocytogenes EGD-e in complex with alpha-D-glucose, beta-D-glucose, magnesium and calcium [Listeria monocytogenes EGD-e],5HPO_A Cycloalternan-forming enzyme from Listeria monocytogenes in complex with maltopentaose [Listeria monocytogenes EGD-e],5HXM_A Cycloalternan-forming enzyme from Listeria monocytogenes in complex with panose [Listeria monocytogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6NSJ0	3.63e-69	86	498	287	703	Myogenesis-regulating glycosidase OS=Homo sapiens OX=9606 GN=MYORG PE=1 SV=2
Q69ZQ1	7.31e-66	86	498	286	705	Myogenesis-regulating glycosidase OS=Mus musculus OX=10090 GN=Myorg PE=1 SV=2
P19965	8.92e-29	185	497	350	670	SITS-binding protein OS=Tetronarce californica OX=7787 PE=1 SV=2
P31434	4.74e-25	64	505	224	664	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2
D2PPM7	1.41e-24	170	502	353	708	1,3-alpha-isomaltosidase OS=Kribbella flavida (strain DSM 17836 / JCM 10339 / NBRC 14399) OX=479435 GN=Kfla_1895 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000022	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002872_01917.