CAZyme Information: MGYG000002870_00891

Basic Information

• Species: CAG-605 sp900545005
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-605; CAG-605 sp900545005
• CAZyme ID: MGYG000002870_00891
• CAZy Family: GT51
• CAZyme Description: Monofunctional glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
932	MGYG000002870_10|CGC1	104344.22	8.9104

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002870	1225239	MAG	United States	North America

• Gene Location: Start: 15236; End: 18034 Strand: -

Full Sequence      

MKKTSNTKKNIKRNIYNMKVKMDSQNTYQRKRKRQNRHIILSLIMVLLIGIMILGLFGII
YIITSAPKFDTDKLYNTSSSILYAKNDTEIGRLGAENRQLVTYDELPQVLVDAIVATEDS
RYFQHNGFDIARFMKASLGQVAGNSKAGGASTITMQVVGMAFTDRKDAKGIAGIIRKFTD
IYMAIFKVEKQYTKEEIIEFYVNTPWLGSNNTYGIEQASQRYFGKSVRDISLPEAAILAG
IFNAPSTYDPFKNIENCTSRRNTVLNLMYRHGYITEDQLNDAKSIPIESLLNQNVDDGLS
KYQWFIDTVQNDVIEKTGKDPAKVPMKIYTTLDTTVQDELNNAGNTNAYYKWKNNKEQLS
MVVTSVSDGSVVALYGGRNQNGVKQLNRATLERYQPGSTAKPIVDYGPAIEYSNASPGTY
YLDDPMSYSNGQSIKNSDSRYLGMITMRVALSRSRNIPALQAFQSVDKDKIASFVNSLGI
NYGDTLYESASIGSFDTVSALQMSAAYATFARGGYYIEPYTFTKIEFIDSGEEYENKYKK
EKVMSDSTAYMINNILVTAHSSYRVGGSYSVSGTDIAAKTGTSTYDGNAVSALGIKTLPS
RDNWTVSYSPDYSISMWYGYDQLYKDAYTTMNGALGVKNALMSKIAKKIFKKNSRFEKPS
SVVEVEVEKETIPLQLPSEYTPSNMRMTEVFKKGTEPTETSFRYQKLDAPTNGKATANGS
TIYLSWNPISTPKAIDNSYLQSYFNDNYKISANKYYEARLSYNNQSIGELRYSIYLQQSN
GTLQFLAETKEPNYTFQDNGSGNYTFIVQANYSIFKANASDYLKIIAGSGTSSVSEISLK
ISSQDECRTKISNTSYYNDNTTITATDINGNNVTDDIKVLDSTIVNTETNEKVSRINLSL
EGKYKITYNVSYNGKTYSTSRLFTIAETCSTD

Enzyme Prediction     

No EC number prediction in MGYG000002870_00891.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	88	269	4.6e-54	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0744	MrcB	5.43e-146	37	703	12	654	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	2.32e-99	33	706	2	773	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
TIGR02071	PBP_1b	3.86e-71	95	644	144	681	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam00912	Transgly	1.36e-64	86	269	1	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG4953	PbpC	7.39e-59	36	808	1	717	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX52380.1	2.24e-134	44	727	52	727
ACJ33515.1	7.93e-131	29	733	18	722
AWI12666.1	8.13e-131	55	727	49	714
AXM90108.1	1.55e-130	29	733	18	722
QFF98737.1	2.08e-130	47	726	32	716

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DWK_A	8.37e-77	82	623	10	560	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	2.70e-74	66	623	3	569	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
3ZG8_B	7.23e-65	187	637	2	449	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3ZG7_B	2.69e-61	187	637	2	449	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
2JE5_A	2.51e-41	98	671	54	661	StructuralAnd Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6],2JE5_B Structural And Mechanistic Basis Of Penicillin Binding Protein Inhibition By Lactivicins [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39793	1.19e-119	63	727	60	728	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
Q00573	4.11e-90	55	620	30	600	Penicillin-binding protein 1A (Fragment) OS=Streptococcus oralis OX=1303 GN=ponA PE=3 SV=1
Q04707	1.93e-85	47	620	20	599	Penicillin-binding protein 1A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=ponA PE=1 SV=2
Q8DR59	2.67e-85	47	620	20	599	Penicillin-binding protein 1A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pbpA PE=1 SV=1
P38050	2.71e-66	43	681	14	630	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999973	0.000047	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
39	61