CAZyme Information: MGYG000002854_01622

Basic Information

• Species: Peptacetobacter sp900539645
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Peptacetobacter; Peptacetobacter sp900539645
• CAZyme ID: MGYG000002854_01622
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
473		50672.78	9.2123

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002854	2123910	MAG	United States	North America

• Gene Location: Start: 1937; End: 3358 Strand: -

Full Sequence      

MNLKRTMTVCMASTMLVSSIIPAFAAEKEVIEGKNMYETAGLIADKQSYSSAILVNLDNS
IADGLSASGLSGAANAPILLTQKDSIPTETMQRLKNVNKVYIIGLEAAVSKKVEETLKNK
GISVERLGGSDRNKTSYSVANKIAQLKNITSIALTNGVKGEADSISIASTAARDGMPVIL
TNGKNVEYNTKNVTTYAIGGTSVISEKLVKSTDAVRLGGSDRYKTNKIILDKFYPNAKEY
YVADGHDLKNALVGSTLAKDAPLMLVSKGSDKSVFKGANKISKIGTLSSSIFEDCLRRAS
SSSSSNNVYSGLSILSKPTSTYEQCKKWAESKNASDLFMEILPILYNTAVENGVDPTLVV
AQCAKETGYCKFGGVLDASFKNPCGLKTPGGGGDKDKNAHTRFDSWEDGVLAQVQHLALY
AGKDGYPLSNPKDPRHFADLFGKCKTVKSLSNNWAGSGYGEDLEKMMKEIMSK

Enzyme Prediction     

No EC number prediction in MGYG000002854_01622.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033435	S-layer_Clost	1.39e-18	59	245	426	642	S-layer protein SlpA. In Clostridiodes difficile, the S-layer protein precursor, SlpA, is one member of a large paralogous family of protein that share several cell wall-binding repeats. SlpA is cleaved into a larger and smaller protein. The S-layer protein itself is important to adhesion, and portions of it are highly variable, and then N-terminal and C-terminal are well-conserved.
pfam04122	CW_binding_2	1.75e-15	31	112	2	80	Putative cell wall binding repeat 2. This repeat is found in multiple tandem copies in proteins including amidase enhancers and adhesins.
pfam04122	CW_binding_2	2.38e-14	126	207	1	80	Putative cell wall binding repeat 2. This repeat is found in multiple tandem copies in proteins including amidase enhancers and adhesins.
COG2247	LytB	1.63e-13	42	194	21	174	Putative cell wall-binding domain [Cell wall/membrane/envelope biogenesis].
pfam04122	CW_binding_2	2.84e-09	216	274	1	59	Putative cell wall binding repeat 2. This repeat is found in multiple tandem copies in proteins including amidase enhancers and adhesins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQQ87376.1	0.0	1	473	1	473
QEK21168.1	0.0	1	473	1	473
AXU46788.1	1.41e-197	2	470	3	476
AXU50448.1	1.41e-197	2	470	3	476
AXU64919.1	1.41e-197	2	470	3	476

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5J6Q_A	6.40e-31	29	285	287	576	ChainA, Cell wall binding protein cwp8 [Clostridioides difficile 630]
5J72_A	7.02e-29	13	268	117	396	ChainA, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630],5J72_B Chain B, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630]
7ACY_B	2.63e-20	43	258	68	311	ChainB, S-layer protein [Clostridioides difficile 630],7ACY_D Chain D, S-layer protein [Clostridioides difficile 630],7QGQ_B Chain B, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_D Chain D, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_J Chain J, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_K Chain K, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_L Chain L, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_M Chain M, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_N Chain N, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_T Chain T, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_U Chain U, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_V Chain V, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_W Chain W, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_X Chain X, Precursor of the S-layer proteins [Clostridioides difficile 630]
7ACX_B	4.79e-20	60	258	83	311	ChainB, S-layer protein [Clostridioides difficile],7ACX_D Chain D, S-layer protein [Clostridioides difficile]
7ACZ_B	1.10e-15	31	234	43	292	ChainB, SLPH (HMW SLP) [Clostridioides difficile R20291],7ACZ_D Chain D, SLPH (HMW SLP) [Clostridioides difficile R20291]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02114	1.74e-25	5	292	6	296	N-acetylmuramoyl-L-alanine amidase LytC OS=Bacillus subtilis (strain 168) OX=224308 GN=lytC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000439	0.998589	0.000233	0.000266	0.000243	0.000217

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002854_01622.