CAZyme Information: MGYG000002846_02501

Basic Information

• Species: Desulfovibrio sp900540515
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Desulfovibrio; Desulfovibrio sp900540515
• CAZyme ID: MGYG000002846_02501
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
982	MGYG000002846_33|CGC1	107310.3	7.9015

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002846	3432213	MAG	United States	North America

• Gene Location: Start: 14269; End: 17217 Strand: +

Full Sequence      

MRRAAAGPCVALRLPLPYHERMDIDSVGPSLCSSASVPPALTVLLTCQGGESPAACLEAL
ARAGAGDATVLCCCPPEREVPIRALGDALLRAGGLAGFRCLPLAPGDDRYAAANRAAGEA
GGSFLLLLSPDALLEPDSLPCLSARLAENSNLAGLNPLLLAPEGGTGPRRIRHLGCVADS
RGQLHYLYEGLPDGHPLAARRRAFQLAHEAALLVRREDFLAVGGFRSGLEGLTVPDFCLR
LAAARKGVFSTEPSARAVLRDSFDSWKKCGLWNSLLQRGRLNPALLRTDYHSQVQADGLE
YGLTPWLAEGPCGLILEEEEGRPDAAWLRWRHAPEPAALLHLLHLLPPERRAQALSLCRE
LPSSLPRAFAWYTDLAARLEDFGGRENLSRLREDAHSWRTRARRFRHGLLRPGLRALADA
GIYACSLDNAPSMYDAWLELRENSLPAADPEAKNLRVERTWPEIAVLMPVWNPEPAFLRA
ALDSVLAQSYGQWQLCLADDASTRPETPELLRSYAARDKRIRLVIRERNGHISRASNSAL
ALADAPWAAFLDHDDLLAPDALLEVARHAAERPGLRFLYSDEDKIDAAGVRRTPIFKADF
DFDLHYTGHLSTYAVAALREADGLRPGLEGSQDFDLSLRVTEKLRPEEIAHIPRILYHWR
IHAGSTTASVATKPYVLEATRRALAESAQRRGLDAAVLPTGKNNFFKLELAVPRNLRCSV
ILLANGPGPLTPGLADCLCKLARRLRLETLWQPLTPSALPAGLPKTWPPRLNGRVLPPAG
PHWSTACRTAARAATGDVLLFLSADLLPVGDCRPEQLAALALRPDLPLVGGCVWKGGLLW
HAGLYPDVMGLPFPLLRGAAPGLLPSLCWGQLLLTRRVLAVSRHCMAVRRKDFLESGGFD
PALGPLAGADYSLRREEQGRFTLISPWGQWLLPSGAEEEKLSPRARECFLERWGDIVRGH
GLRNPQLRAAPDYGWMLDLNGA

Enzyme Prediction     

No EC number prediction in MGYG000002846_02501.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	466	572	1.1e-23	0.6235294117647059

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	8.29e-89	462	661	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
pfam00535	Glycos_transf_2	1.23e-25	466	611	2	134	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	2.00e-24	466	580	1	113	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd06433	GT_2_WfgS_like	1.92e-19	466	668	2	202	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG0463	WcaA	4.53e-18	462	662	3	194	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMD91499.1	0.0	40	978	14	956
VZH32410.1	5.02e-318	39	981	9	1007
SPD36650.1	4.06e-303	31	977	1	1003
ATD81057.1	4.35e-303	31	977	3	1005
ABK52498.1	6.31e-87	413	973	155	730

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	2.83e-06	464	557	7	97	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.03e-61	462	929	366	842	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	2.53e-46	434	913	293	771	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P77414	1.30e-08	462	657	5	206	Putative colanic acid biosynthesis glycosyl transferase WcaA OS=Escherichia coli (strain K12) OX=83333 GN=wcaA PE=4 SV=1
P33702	4.36e-08	463	563	3	104	Succinoglycan biosynthesis protein ExoW OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exoW PE=3 SV=2
P71054	9.94e-08	462	568	5	116	Putative glycosyltransferase EpsE OS=Bacillus subtilis (strain 168) OX=224308 GN=epsE PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002846_02501.