CAZyme Information: MGYG000002835_01958

Basic Information

• Species: Fusicatenibacter sp900543115
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Fusicatenibacter; Fusicatenibacter sp900543115
• CAZyme ID: MGYG000002835_01958
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
294		32603.56	3.8859

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002835	2863124	MAG	United States	North America

• Gene Location: Start: 4417; End: 5301 Strand: -

Full Sequence      

MMRRGILLLLSLGLVLVCSGCSNRQEDTVEPEVSEQNVSSEGGRQEDSETDREADTDVGE
SSEGAARSIPETLEQIPEGYDAPADQQAGTLKHVIDHAIQDGRMQPMIIVCPTYNNTSPE
DSSSYSLALRLTDNYHNELVNDLIPAVEGRYSSYAEDTSPEGVAASRMHRGFGGFSMGSV
ATWHTFQYCLDEFYYFMPMSGSFTTDGDFMSQIVTESGYGPEDFFIYAMSGTDDFAYSAF
ARQIEAMLETSDGNFVEADNEKEGNLAFRVQEGGTHNGEYAEQYIYNGLCWFWN

Enzyme Prediction     

EC	3.2.1.8	3.1.1.73

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	94	289	6.3e-19	0.7444933920704846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	2.22e-06	87	205	111	214	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADA67819.1	8.60e-54	91	245	121	275
AFH62884.1	1.87e-41	87	289	411	613
AEI42872.1	1.87e-41	87	289	411	613
AGA59285.1	3.14e-41	90	289	404	600
AEY68182.1	2.96e-40	91	289	483	681

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GKL_A	9.98e-44	91	294	92	288	ChainA, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],1GKL_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],1WB4_A Chain A, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],1WB4_B Chain B, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],1WB5_A Chain A, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],1WB5_B Chain B, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],1WB6_A Chain A, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],1WB6_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus]
6FJ4_A	1.36e-39	91	294	78	274	ChainA, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus]
1GKK_A	1.91e-39	91	294	92	288	ChainA, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],1GKK_B Chain B, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],3ZI7_A Chain A, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus YS],3ZI7_B Chain B, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus YS],4BAG_A Chain A, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],4BAG_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],4H35_A Chain A, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],4H35_B Chain B, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],5FXM_A Chain A, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],6Y8G_AAA Chain AAA, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],6Y8G_BBB Chain BBB, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus]
1JJF_A	4.53e-09	89	202	83	179	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	1.11e-08	89	202	83	179	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P51584	4.43e-40	91	294	880	1076	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1
P10478	5.88e-08	89	202	102	198	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000002	1.000059	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002835_01958.