CAZyme Information: MGYG000002834_01083

Basic Information

• Species: Prevotella sp900551985
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900551985
• CAZyme ID: MGYG000002834_01083
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402		46445.19	9.102

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002834	3427886	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 2360; End: 3568 Strand: +

Full Sequence      

MRKILMMLAAAALALPLSAAQPAKKTAKVKKQNKKEVKASRKWDHEQVVALITKVNNYWQ
ANNKPEVRAFWDNAAYHTGNMEVYKMLKDQKMLDYTIRWAEHNDWTGATEANPAKWKYKP
YGEGKDHVLFGDWQICFQTYIDLYNIEAAKGNAAASEFMVKRAKEVMHYEAYSEPTDYWW
WSDALYMVMPVMTKMYKLTGDVKYLDKLYDNLLTTDEIMLDKETNLYFRDGKYIYPKHKS
ANGKKDFWARGDGWVLAGLAKVLQDMPKDYKHYQFFVDKFQKLAKAVAEIQQPEGYWTRS
MMDPEHAPGPETSGTAFFTYGMLWGVNNGYLNKKEYKKVIDRAWTYLTETAVQEDGKVGY
VQPIGERAIPGQTVDANSQANFGVGAMLLTACEYDKYLNTKL

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	62	395	2.9e-79	0.9789156626506024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	3.51e-85	52	398	2	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	6.90e-40	53	362	18	314	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ79822.1	2.83e-202	40	399	18	370
ADE82673.1	2.32e-201	40	398	18	369
AGB28481.1	5.81e-190	40	398	19	378
BCS84432.1	1.82e-186	48	402	10	367
QQY40390.1	1.02e-176	36	398	20	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	1.96e-168	47	400	32	377	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	1.07e-145	46	398	14	358	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	1.18e-55	71	393	53	365	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	2.60e-13	178	356	138	322	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.06e-12	178	356	128	312	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	7.69e-55	71	393	60	372	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	6.26e-53	173	393	151	371	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	1.99e-45	179	393	199	407	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	1.43e-12	178	356	138	322	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.007982	0.984231	0.006966	0.000329	0.000248	0.000218

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002834_01083.