CAZyme Information: MGYG000002834_00199

Basic Information

• Species: Prevotella sp900551985
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900551985
• CAZyme ID: MGYG000002834_00199
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1036		117859.45	8.6344

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002834	3427886	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 23600; End: 26710 Strand: -

Full Sequence      

MRKRLLLLLLAFIAIVNANAVERTKLNFNGGWLLKVGDLKSAELPDYNDKSWKQVTLPRA
FNEKEAFKVSIEHLSDTIMWYRKHFHIQEVGDRKYFIEFEGVRFGADIWLNGKKVGYTEN
GVMASGFDLTPYIIKGENVIAVRVDNSWSYRERTTGQRYQWNDKNFNANYGGIPKNVFLH
ITDKLYQTLPLYNNLKTTGTYIYGSNYDIAGKKVTVNAESQVRNEDSKPRSFRFFAKILD
ADGKEMGHFDGERYTLKPGETKTVKVSGLLNNAHFWSWGYGYLYTVKTLLKADDGSKIDD
VVTKTGFRKTQFGKGKFYLNDRAIMMHGYAQRTSNEWPGVGMSVPAWLSDYSNKLMVESG
GNLVRWMHVCPWKQDIESCDRVGLIQAMPAGDAEKDVEGRRWEQRLELMKEAIIYNRNNP
SIIFYESGNKGVSREHMLQMKAIRDEFDPHGGRASGSREMLNINEAEYGGEMLYINKSKK
HPMWSMEYHRDEGLRKYWDEQSYPYHKEGDGPLYRGKPAFEYNHNMDTFAASMVERWFEY
WQERPGSGKRVSDGGTKIIFSDTNTHHRGEANYRSSGVTDAMRIPKDAFFAHQVMWDGWV
SPEKDATYIVGHWNYKPGTIKQTEYVVSTGDEVELFVNGKSLGMGERSNQWLFTWKNVPF
EAGKIEAVAYTYDKSDKKSKDAKTKKETSRYAIETAGEPHHIKLTSIQNPEGFKADGADM
ALIQVEVVDKQGRRCPLDNRTIHFNYQGEMEWIGGLATPNEDMKKALAAKKQSLVVDKNE
TVEQKAARKAADILDSTDSDNTFDNYIGKIDLPVECGVNRVLIRSTVNPGNITICAGADG
IKGVASINLQTQKVDIEHYLPQFSLKGDLSRGETPSTPSYTDIKETIDITGVIAGSNQED
AQKTFDDDETSEWKSDGKPENAWITCQFAKKEKVDEITMKLTGWRDKMYPLAIFAGKKKV
WEGYTYACLGYVHIKIDKPVKAKDITIRMIGDAKSKTQLSDTKELAGGKASTLDFIGIKK
GKPVLRIVEIDFLKNK

Enzyme Prediction     

EC	3.2.1.31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	19	541	5.2e-64	0.5837765957446809

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.05e-27	25	531	27	519	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	3.31e-21	81	429	113	448	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK10150	PRK10150	2.00e-18	23	449	10	431	beta-D-glucuronidase; Provisional
pfam02837	Glyco_hydro_2_N	1.89e-12	78	179	66	165	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
pfam16355	DUF4982	3.97e-12	625	671	7	54	Domain of unknown function (DUF4982). This family is found in the C-terminal of uncharacterized proteins and beta-galactosidases around 680 residues in length from various Bacteroides species. The function of this protein is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS85036.1	0.0	23	1035	25	987
AGB29275.1	0.0	3	1035	4	1028
QNL41159.1	0.0	5	1035	7	985
ALJ49030.1	0.0	5	1035	7	985
QRQ55837.1	0.0	5	1035	7	985

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPD_A	9.86e-141	22	860	34	813	Thestructure of a beta-glucuronidase from glycoside hydrolase family 2 [Formosa agariphila KMM 3901]
7CWD_A	1.68e-49	25	754	3	746	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
5T98_A	7.52e-46	26	748	28	758	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
4YPJ_A	1.58e-43	25	754	9	752	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
4CUC_A	5.46e-40	21	754	11	784	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA. [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KN75	4.34e-140	22	860	25	804	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
A7LXS9	1.41e-41	23	760	42	798	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KPJ7	1.82e-37	22	779	50	801	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
T2KM09	3.66e-35	8	753	31	763	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
P77989	1.29e-32	23	754	3	695	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000200	0.999196	0.000148	0.000152	0.000141	0.000129

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002834_00199.