CAZyme Information: MGYG000002834_00116

Basic Information

• Species: Prevotella sp900551985
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900551985
• CAZyme ID: MGYG000002834_00116
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
802		91465.67	8.2328

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002834	3427886	MAG	United Republic of Tanzania	Africa

• Gene Location: Start: 28000; End: 30408 Strand: -

Full Sequence      

MVYKYKRILFAVLAASMSLSAFAFNLKTGSPVVVQGDTLQMAPVAKTALKMLQGDIRKVL
GAEMKLQSAGGGDQNTIVLSKDAAAFAYKKEAFQLKAENGNLYIKGSDDHGLAYGILEVS
RLLGVSPWEWWADAKPKHLDMFSLKDGYHNEQAPSVEFRGIFINDEDWGLMPWSGKTYEP
SDIKGHIGPKTNARIFELLLRLRANTYWPAMHECTRPFFLTEGNREVALQYGIYIGGSHC
EPMASSTAGEWPARGKGEYDFLNNKENVLQFWEDRVKEVAKQPILYTIGMRGVHDGAMQG
AKGVQEQKTVLDSVLVAQRELLAQYVNKDVTQVPQLFIPYKEILEVYNAGLHVPDDVCLV
WCDDNYGMVRHFPTAAERARKGGNGIYYHVSYWGRPHDYLWLGTFSPSLLYQQMSMAWHK
GIQKFWILNVGDIKPAEYQIELFLDMAWNMNNIYPGDNAEKELQPNNQWLAEHEKNFWTR
EFGKELAEKMLPVMLESYRLAYIRKPEFLANTRCEERDKKYQIISDLPWSEAYIQTRLAD
YKKLADQAEKIEKMLDKAIAKGDLPKERKDEFCQLFTYPVQAAAQMNDKLLYGQLARHGK
ETSKDGGAGYWAKSDAAFDSIARLTQIYNQGYYNHGKWNRMMDFQPRKQPVFNRVPHTEA
TAAMVKDPQYIAKWNATDANVGHPIAWYGLGYEGKAASIVRNQEIGFDFGGKKVKGDSVT
IEVRWVPTHPVDNKLRFALSLDGGKPVEKEYQTEGRSEQWKVNTLQCQARVRIQLPIAKM
KKHRILIKALDEGLVLDQVCIY

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	42	799	6.7e-206	0.9684361549497847

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	1.22e-166	152	508	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	8.20e-10	717	802	68	159	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam02838	Glyco_hydro_20b	2.63e-04	23	116	17	101	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR62690.1	0.0	21	802	17	764
EEB24254.1	0.0	21	802	6	753
QJR71288.1	0.0	21	802	17	764
QJR66948.1	0.0	21	802	17	764
QJR75325.1	0.0	21	802	17	764

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5BY3_A	2.16e-312	24	802	20	774	Anovel family GH115 4-O-Methyl-alpha-glucuronidase, BtGH115A, with specificity for decorated arabinogalactans [Bacteroides thetaiotaomicron VPI-5482]
4C90_A	2.38e-85	104	642	145	640	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PXQ_A	4.44e-82	102	642	115	624	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PUG_A	6.25e-82	102	642	116	625	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	6.72e-79	102	639	116	607	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000282	0.998939	0.000205	0.000183	0.000178	0.000158

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002834_00116.