CAZyme Information: MGYG000002828_01170

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; Intestinimonas
• CAZyme ID: MGYG000002828_01170
• CAZy Family: GT39
• CAZyme Description: putative dolichyl-phosphate-mannose--protein mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380		43447.06	9.4369

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002828	2102749	MAG	Singapore	Asia

• Gene Location: Start: 58; End: 1200 Strand: +

Full Sequence      

MTPFGWRFMGALFGVLMLPILYVFLKNLFGKTPIAACGTALFAFDFMHLTQTRIATIDTY
GVFFILLMYFFLYRYLTLPAGTSFRKGALPLFLSGLTWGLGAASKWTVIYGGAGLAILYF
TGLYFKWRDWPRDEAGRREGFGPWCGRTIAFSVLCFVLIPVVIYTLSYWPYAVAKGDTSL
RNLITVMVENQKFMFTYHNGVHDFHPYSSQWYQWIVDGRPILYYLDDSQVDTTGLKAAFG
CFNDPVVAWAGLLAVVSILARAVITLIERVRNVPFSFRPMGGTALFITVGYFSQLAPWFL
IGRTTFEYHYFPSTLFLVLAVCFAFHELTEYRPRAWKGWVWSVTGLSVALYPLFYPVLIG
LSVPTWYTTNLLKWLPSWPF

Enzyme Prediction     

No EC number prediction in MGYG000002828_01170.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	2	171	4.5e-35	0.7130044843049327

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16192	PMT_4TMC	2.95e-15	187	376	3	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG1928	PMT1	6.73e-15	182	380	496	695	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
COG1928	PMT1	1.66e-14	2	169	108	265	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	1.53e-09	4	170	83	239	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam13231	PMT_2	2.17e-06	4	159	22	159	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALP95330.1	1.95e-168	1	380	319	752
QBB67038.1	1.95e-168	1	380	319	752
ANU42918.1	6.10e-160	1	380	288	653
QQR07704.1	6.10e-160	1	380	288	653
QIA32159.1	3.06e-159	1	380	284	649

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WN04	1.36e-15	4	378	122	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	1.36e-15	4	378	122	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
Q8NRZ6	1.90e-11	2	378	117	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000004	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
4	25
60	82
106	128
149	171
245	267
280	302
306	325
338	360