CAZyme Information: MGYG000002825_02899

Basic Information

• Species: Klebsiella_A indica
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella_A; Klebsiella_A indica
• CAZyme ID: MGYG000002825_02899
• CAZy Family: PL38
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
411		46866.16	8.4163

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002825	5145656	MAG	Singapore	Asia

• Gene Location: Start: 139376; End: 140611 Strand: -

Full Sequence      

MNSILRRGLLCVALCCSSLSAILYAAEPYTLDEKDLAFSRQRIAANDPLFIQAQAALLKK
ADLALRHPLFSVMDKTLVAASGNKHDYYSFPPYWWPNPDTKDGLPYIRKDGQINPDASNN
ATDKNRLVKMSNDVSTLALAWYFSRDNRYAQKAVEQLKTWFLAPKTRMTPNLQYAQAIPG
INTGRGIGIIDSRALVEVVDAIAVLQSSDALNEKDVTALKQWFAKFYHWMTTSQNGIEEG
NRHNNHGTWFDMQAVAFALFCGKTDEAKKRLELTRLQRITGQFDAEGRQMAELERTRSWH
YSNFNLEAYNRLGQLGERVGINIWNVTRDDHSLRKGYQYVAGFINSDTPWPWKDLDKMDD
KKALRNIATAAHVWPDDPLFREKAQWLRAKYPDDITTLIAPLSPVSAFEEH

Enzyme Prediction     

No EC number prediction in MGYG000002825_02899.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	72	350	7.7e-118	0.996415770609319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05426	Alginate_lyase	4.09e-88	71	350	1	274	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.
pfam16889	Hepar_II_III_N	0.004	52	160	25	133	Heparinase II/III N-terminus. This is the N-terminal domain of heparinase II/III proteins. It is a toroid-like domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APM30356.1	6.88e-264	1	411	1	411
ASK72722.1	6.88e-264	1	411	1	411
AUV91710.1	6.88e-264	1	411	1	411
AID90882.1	6.88e-264	1	411	1	411
AOV12781.1	6.88e-264	1	411	1	411

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NFV_A	3.12e-74	45	362	21	340	Crystalstructure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.95 A resolution [Bacteroides ovatus ATCC 8483],3NNB_A Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.60 A resolution [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.005536	0.944593	0.048373	0.000723	0.000422	0.000314

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002825_02899.