CAZyme Information: MGYG000002818_03509

Basic Information

• Species: Tissierella sp002266425
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Tissierellaceae; Tissierella; Tissierella sp002266425
• CAZyme ID: MGYG000002818_03509
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
216	MGYG000002818_46|CGC1	24991.99	8.8094

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002818	4155491	MAG	United States	North America

• Gene Location: Start: 20376; End: 21026 Strand: +

Full Sequence      

MFKTIKKIKKIIIFIAAIFLILTIGIILLTTNYPIGYKSMIVEYSKEYDLDPYLVASIIN
VESKYDKDAISQKGARGLMQISPSTGKWASEVLGIDNYSEDILFDPETNIRIGTWYLDTL
FKEFDYNLELVLAAYNAGSGNVSKWLKDEKYSNDRTSLSIIPFKETEDYLVRVNQSYKVY
STLYKKYIMNPSDKDSVYINLLHNIRKIIKEIIRNV

Enzyme Prediction     

No EC number prediction in MGYG000002818_03509.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	46	181	8.1e-31	0.8518518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.35e-73	34	179	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	3.62e-53	33	183	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	3.46e-41	52	178	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	5.09e-36	32	184	134	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	1.89e-32	41	147	1	104	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SHD77963.1	1.55e-72	5	213	5	215
QQY80409.1	2.12e-72	6	213	6	214
AFS78006.1	2.52e-64	31	186	35	190
QZY57461.1	1.90e-63	20	185	3	174
QAT63457.1	2.19e-60	33	213	2	183

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	4.91e-22	29	191	441	599	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	5.02e-22	29	191	470	628	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FCQ_A	1.24e-21	29	191	441	599	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FC4_A	1.24e-21	29	191	442	600	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
5MPQ_A	2.20e-19	30	184	409	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31976	1.52e-18	32	177	1417	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	1.52e-18	32	177	1417	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P39434	3.15e-18	29	173	472	618	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC3	7.87e-18	29	173	472	618	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	7.87e-18	29	173	472	618	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.992676	0.006283	0.000169	0.000035	0.000019	0.000838

TMHMM  Annotations     

start	end
13	35