CAZyme Information: MGYG000002818_01610

Basic Information

• Species: Tissierella sp002266425
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Tissierellaceae; Tissierella; Tissierella sp002266425
• CAZyme ID: MGYG000002818_01610
• CAZy Family: GH18
• CAZyme Description: Chitinase A1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388		44225.6	8.8908

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002818	4155491	MAG	United States	North America

• Gene Location: Start: 80264; End: 81430 Strand: +

Full Sequence      

MNMNSIYKKKLVFSILTCFLAFTLLSTTPKAMANIVSKEQLKNVGYYTSWSAYSNFTPDK
IDATKLTHINYAFANVNEELKITLGDSYIDPSNIKKLNELKKINPNLKILISVGGWSWSD
KFSDAALTDKSRTIFANSCVDFIKKYGFDGIDIDWEFPVSGGPPTNKYRKEDKQNFTLLL
KAIREKLDIQCKKDGKHYLLTIAGGAGSMGIDNVELWNIHRYLDFANIMTYDMHGTWDKY
TDFNAPLYGGNSPNYVKSSVDTAVKSWINAGFPKEKIVMGIPFFGKQYNMVNVWNNGLYQ
TFNGGLSLSYADIVSKYLNKQGFIRYYHSEYMVPWLYNGTTFISYEDEESIGHKAEYIKL
NGLGGAMIWELKQDPNSILLDKLYKSLQ

Enzyme Prediction     

No EC number prediction in MGYG000002818_01610.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	42	376	2.8e-88	0.9391891891891891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06548	GH18_chitinase	4.46e-137	43	374	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
smart00636	Glyco_18	3.21e-124	42	374	1	334	Glyco_18 domain.
cd02872	GH18_chitolectin_chitotriosidase	8.74e-110	44	374	2	341	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
COG3325	ChiA	1.44e-109	23	388	14	437	Chitinase, GH18 family [Carbohydrate transport and metabolism].
pfam00704	Glyco_hydro_18	4.56e-106	42	374	1	307	Glycosyl hydrolases family 18.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHI73896.1	6.64e-165	42	388	17	364
BCN31452.1	2.77e-164	44	388	172	517
QHQ61676.1	2.51e-156	40	388	195	544
BCJ99004.1	9.33e-155	26	388	185	548
SET91583.1	2.06e-154	42	388	108	455

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ITX_A	7.13e-106	33	383	4	415	ChainA, Glycosyl Hydrolase [Niallia circulans]
6KST_A	2.87e-96	44	381	10	364	Crystalstructure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXM_A	1.63e-95	44	381	10	364	Crystalstructure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXM_B Crystal structure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXN_A	3.68e-94	44	381	10	364	Crystalstructure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXN_B Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6BT9_A	2.83e-88	38	387	34	470	ChitinaseChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20533	1.17e-102	1	383	4	447	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
P48827	1.94e-61	43	374	40	383	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1
P32470	2.10e-60	3	370	1	379	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
Q13231	2.12e-60	42	374	23	363	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
Q1E3R8	1.26e-59	42	374	39	383	Endochitinase 1 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000341	0.998998	0.000182	0.000175	0.000153	0.000140

TMHMM  Annotations     

start	end
12	29