CAZyme Information: MGYG000002817_03969

Basic Information

• Species: Paenibacillus_B sp900539405
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_B; Paenibacillus_B sp900539405
• CAZyme ID: MGYG000002817_03969
• CAZy Family: GT1
• CAZyme Description: Demethyllactenocin mycarosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393		44018.54	7.1271

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002817	6425839	MAG	United States	North America

• Gene Location: Start: 98946; End: 100127 Strand: -

Full Sequence      

MSKIVFFSIPAHGHTNPTIPVVTELVNRGHQVWYYSFLEFQGKIEGAGAAFIACDEFLPH
LSQKELNRKVGKDFAALIEMVADTTIALDEKVCKELREIQPDCIVSDSLCFWGKLFAKKL
GIPYVCSTTTFAFNQHTAKLMKRGFIELWRMIVGLPRINKKIQLLQDHGYEVENFVSIIQ
NNNETDTIVYTAKEFQPMAGTFSERYAFVGPSIRQSPPVQNNKKDRKIIYISLGTVLNQN
QDFYQNLIQAFADTDYDVVMSVGEKTEISSLGYIPGNFTVKNFVDQISVLQTADVFITHC
GMNSANESLYFGVPMVLFPQHSEQRLVAERVAELGAGLKLQGKKPKYLAAAVSEVLANRT
YQENAQKLSETFQSAGGAVEAANVIISKIREKT

Enzyme Prediction     

No EC number prediction in MGYG000002817_03969.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	49	387	1.8e-45	0.8638743455497382

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01426	MGT	2.10e-106	7	385	1	386	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
cd03784	GT1_Gtf-like	4.26e-72	3	385	2	401	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
COG1819	YjiC	1.51e-71	1	392	1	402	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
PHA03392	egt	1.44e-14	222	368	292	442	ecdysteroid UDP-glucosyltransferase; Provisional
cd03785	GT28_MurG	3.75e-12	13	369	11	339	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDM45718.1	4.83e-282	1	392	1	392
SYX81875.1	5.02e-259	1	393	1	393
QAS55940.1	7.17e-236	1	393	1	393
QPA51956.1	2.05e-235	1	393	1	393
AMR91286.1	2.05e-235	1	393	1	393

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KQW_A	1.23e-57	4	382	6	378	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6KQX_A	1.39e-57	4	382	6	378	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168],7BOV_A Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
2IYA_A	1.35e-46	4	385	15	416	Thecrystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus],2IYA_B The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus]
3IA7_A	4.90e-43	4	385	7	393	CrystalStructure of CalG4, the Calicheamicin Glycosyltransferase [Micromonospora echinospora],3IA7_B Crystal Structure of CalG4, the Calicheamicin Glycosyltransferase [Micromonospora echinospora]
6J31_A	8.60e-42	4	385	7	390	CrystalStructure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31853	2.02e-65	1	393	1	400	Uncharacterized UDP-glucosyltransferase YojK OS=Bacillus subtilis (strain 168) OX=224308 GN=yojK PE=3 SV=2
O34539	7.62e-57	4	382	6	378	NDP-glycosyltransferase YjiC OS=Bacillus subtilis (strain 168) OX=224308 GN=yjiC PE=1 SV=1
O05496	1.24e-55	1	392	1	393	Uncharacterized UDP-glucosyltransferase YdhE OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhE PE=3 SV=2
Q65JC2	1.03e-53	4	385	6	386	NDP-glycosyltransferase YjiC OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=yjiC PE=1 SV=1
Q9XC67	1.57e-43	1	385	58	453	Demethyllactenocin mycarosyltransferase OS=Streptomyces fradiae OX=1906 GN=tylCV PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002817_03969.