CAZyme Information: MGYG000002817_03204

Basic Information

• Species: Paenibacillus_B sp900539405
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_B; Paenibacillus_B sp900539405
• CAZyme ID: MGYG000002817_03204
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
222		24733.14	5.7445

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002817	6425839	MAG	United States	North America

• Gene Location: Start: 76104; End: 76772 Strand: -

Full Sequence      

MALAAHTLDTQIRKTVHIQYLLHLPSEYDASSDQKWPVLLFLHGAGERGDDLDKVKVHGP
PKLAEHADLPFIIVAPQCPEHSHWQLEMDAVIALLDEVTAAYRADTDRIYVTGLSMGGFG
TWSLGIAYPDRFAALVPICGGTNPQQAPLVKQVPVWVFHGAKDTVVPLSQSEAMVEALRE
AGGNVKLTVYPEAGHDSWTETYNNEELYEWLLRQSLRSRLKR

Enzyme Prediction     

No EC number prediction in MGYG000002817_03204.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	17	212	1.7e-35	0.9427312775330396

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4099	COG4099	7.20e-56	16	216	172	387	Predicted peptidase [General function prediction only].
COG1506	DAP2	9.03e-18	18	215	378	617	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
pfam00326	Peptidase_S9	3.41e-15	85	214	42	209	Prolyl oligopeptidase family.
COG3509	LpqC	2.18e-13	19	167	48	205	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
COG0400	YpfH	3.35e-13	36	211	18	202	Predicted esterase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VTR91196.1	1.07e-71	9	214	34	237
QJW99051.1	7.64e-71	3	214	29	238
QDU56037.1	1.94e-69	18	214	801	1005
BCI61582.1	2.23e-46	20	214	827	1041
ABS60377.1	2.65e-42	36	211	37	240

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DOH_A	3.79e-48	16	215	156	379	CrystalStructure of a Thermostable Esterase [Thermotoga maritima],3DOH_B Crystal Structure of a Thermostable Esterase [Thermotoga maritima],3DOI_A Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima],3DOI_B Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima]
3WYD_A	5.70e-30	17	210	20	211	C-terminalesterase domain of LC-Est1 [uncultured organism],3WYD_B C-terminal esterase domain of LC-Est1 [uncultured organism]
4H0C_A	3.62e-08	39	195	25	194	ChainA, Phospholipase/Carboxylesterase [Dyadobacter fermentans DSM 18053],4H0C_B Chain B, Phospholipase/Carboxylesterase [Dyadobacter fermentans DSM 18053]
1JJF_A	1.40e-07	22	143	50	181	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	3.46e-07	22	143	50	181	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P71505	7.50e-08	87	195	145	259	Putative carboxymethylenebutenolidase OS=Methylorubrum extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1) OX=272630 GN=MexAM1_META1p1735 PE=3 SV=2
B8YG19	1.58e-07	37	180	73	217	Bifunctional acetylxylan esterase/xylanase XynS20E OS=Neocallimastix patriciarum OX=4758 GN=xynS20E PE=1 SV=1
P10478	1.33e-06	22	143	69	200	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
Q8ZAL4	1.39e-06	102	195	124	226	Putative carboxymethylenebutenolidase OS=Yersinia pestis OX=632 GN=YPO3787 PE=3 SV=1
Q51718	3.62e-06	36	196	72	261	Poly(3-hydroxyoctanoate) depolymerase OS=Pseudomonas fluorescens OX=294 GN=phaZ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002817_03204.