CAZyme Information: MGYG000002817_01001

Basic Information

• Species: Paenibacillus_B sp900539405
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_B; Paenibacillus_B sp900539405
• CAZyme ID: MGYG000002817_01001
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
262		28953.86	7.314

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002817	6425839	MAG	United States	North America

• Gene Location: Start: 235717; End: 236505 Strand: +

Full Sequence      

MSYREGNFAAQEIYRLEKKGKTETLIVRSADFNSPDNKEKPVITRIVDFGSFLNEGLEKD
RKRDLAALLANLSHETGGGWDEAPGGMLRWGLYWNENIAGRTGQNKSDFVDPASSKEYPG
FPGKKYYGRGPIMLSWNFNYGLMSAIIYGDKNVLLKNPEAIAADGKLGFATAILFWMTPQ
APKPSAHDVMIGRWKPSQEEAAQGLTPPGFGISIMVLNGLEANLDDTNGAIKRRAGHYRD
ITSRMGVDITGEKIDTLGMQPF

Enzyme Prediction     

No EC number prediction in MGYG000002817_01001.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	48	254	3.9e-51	0.8051948051948052

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00325	chitinase_GH19	1.28e-71	23	256	7	224	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
pfam00182	Glyco_hydro_19	1.25e-53	49	255	37	231	Chitinase class I.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SYX82448.1	5.92e-170	1	262	151	412
QAV19045.1	1.78e-140	4	262	169	422
AVV54755.1	1.21e-139	4	262	168	427
ANA81127.1	1.21e-139	4	262	168	427
AWP29402.1	1.72e-139	4	262	168	427

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CQL_A	9.48e-48	49	262	41	242	CrystalStructure of GH family 19 chitinase from Carica papaya [Carica papaya],3CQL_B Crystal Structure of GH family 19 chitinase from Carica papaya [Carica papaya]
2DKV_A	3.96e-47	49	262	97	298	Crystalstructure of class I chitinase from Oryza sativa L. japonica [Oryza sativa Japonica Group],3IWR_A Crystal structure of class I chitinase from Oryza sativa L. japonica [Oryza sativa Japonica Group],3IWR_B Crystal structure of class I chitinase from Oryza sativa L. japonica [Oryza sativa Japonica Group]
2Z37_A	7.71e-47	43	262	35	243	Crystalstructure of Brassica juncea chitinase catalytic module (Bjchi3) [Brassica juncea],2Z37_B Crystal structure of Brassica juncea chitinase catalytic module (Bjchi3) [Brassica juncea],2Z37_C Crystal structure of Brassica juncea chitinase catalytic module (Bjchi3) [Brassica juncea],2Z37_D Crystal structure of Brassica juncea chitinase catalytic module (Bjchi3) [Brassica juncea]
2Z38_A	8.39e-47	43	262	38	246	Crystalstructure of chloride bound Brassica juncea chitinase catalytic module (Bjchi3) [Brassica juncea]
2Z39_A	1.62e-46	43	262	37	245	ChainA, Chitinase [Brassica juncea],2Z39_B Chain B, Chitinase [Brassica juncea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q05537	1.60e-49	43	262	38	245	Basic endochitinase (Fragment) OS=Solanum lycopersicum OX=4081 GN=CHI14 PE=2 SV=1
P85084	1.31e-47	49	262	41	242	Endochitinase OS=Carica papaya OX=3649 PE=1 SV=1
Q5NB11	3.71e-46	49	262	88	290	Chitinase 10 OS=Oryza sativa subsp. japonica OX=39947 GN=Cht10 PE=2 SV=1
Q7DNA1	4.65e-46	49	262	128	329	Chitinase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=Cht2 PE=1 SV=1
Q42993	3.37e-45	49	262	118	321	Chitinase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Cht1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000014	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002817_01001.