CAZyme Information: MGYG000002815_00922

Basic Information

• Species: Anaerococcus prevotii_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Peptoniphilaceae; Anaerococcus; Anaerococcus prevotii_A
• CAZyme ID: MGYG000002815_00922
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
392	MGYG000002815_4|CGC1	46108.22	4.9468

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002815	1697277	MAG	United States	North America

• Gene Location: Start: 161127; End: 162305 Strand: +

Full Sequence      

MNKINGVNLGGWLVLEKWMTTELFRKTKADDEYYLAHDLDPMIYEDRINMHRKYFINESD
IARMKSQGITHIRVPVPYFIFGDRKPFIPCVENLDELFNWADFYGLKVLLDMHSVAYSQN
AFDNGGLSGVCKWASIEEEVNFVEDVLVKLGKRYRDRKSFWGIEVLNEPATPAIWDTMNP
IKRFPPRDKEMSKGSAPISFDFLYDFYKRTYNKLRGVIKEETYIVFHDGFSLDKWESFFK
ENEFKNVILDTHQYIMTAELEGVDLNLEAYSNYLYNLKDKLEKVSGYVKLIVGEWSLFNS
YAIGIDTKGGLNPNQVNYDDINKLDKNKVKTIYQALWNKSKEAWSVTEGDFYWTYKLNID
TINNPSWYGWDSWDFDRCVSKGWIDLEGTNEN

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	50	356	7.1e-118	0.9966887417218543

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	1.20e-15	3	175	17	200	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	8.13e-04	54	184	23	146	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSD63048.1	2.48e-175	3	385	4	386
AEU40475.1	1.00e-174	3	385	4	386
AGV73077.1	5.77e-174	3	385	4	386
QRZ32526.1	5.77e-174	3	385	4	386
ARE23414.1	8.19e-174	3	385	4	386

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	9.69e-147	3	384	2	386	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	7.87e-146	3	384	2	386	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
1H4P_A	1.62e-30	4	258	13	261	Crystalstructure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae],1H4P_B Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
1EQP_A	2.78e-24	2	296	7	288	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]
2PF0_A	5.53e-24	2	296	13	294	ChainA, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7Z9L3	1.06e-35	3	296	30	300	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
B8N151	1.06e-35	3	296	30	300	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
Q5AIA1	5.98e-34	6	382	44	437	Glucan 1,3-beta-glucosidase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EXG2 PE=1 SV=2
Q12628	2.05e-33	3	390	35	418	Glucan 1,3-beta-glucosidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=KLLA0C05324g PE=3 SV=1
Q5B5X8	2.59e-32	3	367	28	379	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002815_00922.