CAZyme Information: MGYG000002811_01294

Basic Information

• Species: UMGS1994 sp900556975
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; UMGS1994; UMGS1994 sp900556975
• CAZyme ID: MGYG000002811_01294
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
273		32435.72	6.5031

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002811	1736572	MAG	Peru	South America

• Gene Location: Start: 2999; End: 3820 Strand: +

Full Sequence      

MNNMAIPKKIHYCWFGRGEKPELAKKCIESWKKYCPDYEFKEWNEDNFDIHSNKYVEQAY
NARKFAFVTDYVRLYALYYEGGVYMDTDVEVLKPIDEFLKHKAFSSFENNNTIPTGLMAS
EKGNEWIKDLLDEYTDLNFIDEDGNMDLTTNVTRITNLTHEKYGLKLESSYQELKNGIVT
LYPYDYFCPKDWSTGEIHLTENSATIHHFSGSWHTAQEKEKANIYREKLEKYIAKYHDED
IAREKLNKDELRKFYLKHPLKAVKKIIEKMKGK

Enzyme Prediction     

No EC number prediction in MGYG000002811_01294.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	23	101	2.1e-26	0.9666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	2.70e-21	5	134	81	214	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	6.96e-18	21	104	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	1.30e-10	6	132	46	186	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	0.007	52	117	157	216	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ56458.1	4.61e-91	6	224	2	218
BAD50395.1	7.55e-90	6	224	2	218
QHR93120.1	1.36e-88	6	224	2	219
QLA08259.1	1.36e-88	6	224	2	219
QCQ51959.1	3.52e-88	6	224	2	218

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q10323	2.48e-06	5	127	56	181	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002811_01294.