CAZyme Information: MGYG000002811_01077

Basic Information

• Species: UMGS1994 sp900556975
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; UMGS1994; UMGS1994 sp900556975
• CAZyme ID: MGYG000002811_01077
• CAZy Family: GH57
• CAZyme Description: 1,4-alpha-glucan branching enzyme

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
529		62302.82	6.4149

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002811	1736572	MAG	Peru	South America

• Gene Location: Start: 2046; End: 3635 Strand: -

Full Sequence      

MDKNKGYVTFILHAHLPFIHHPESEDYLEEQWLFEAMSETYIPLLLNFKKLEEENVKFRL
TMTMTPPLLYMLDNKLLQERYIKYLKKHIELAKKELKRTVYDERVHNLAQYYYDRYSNDL
HVFRDVYDCNLITGFKHFQDAGFLEIITCGATHGYFPILYVTPQTVRAQIAVGVQTYKKY
FGRQPRGIWLPECGYIPEADQYLKEFGIEYAIVESHGILYADPAPLYGTFAPIVSPGGLV
AFGRDIESSKQVWSSICGYPGDFNYREFYRDIGYDLDYDYIKPYIASNGVRVHTGIKYYR
ITSKSGEKDYYNPRWAMDTAERQAGHFLDSRTAQIDTLAKFIDTPPIVVCPYDAELYGHW
WYEGPYWLYVLFKKIYYDDCNFSLITPGDYIDRHPNIQVASPCRSSWGANGYSEVWLNPT
NDYAHRHLHKAGNRMVELANMFPDEEDGTRKKALNQCARELLLAQSSDWLFIITNGTMVD
YAKKRIKQHIGRFTKLYYQIKNDKIDEKFVDDIYEQDLIFTDIDYRIYK

Enzyme Prediction     

EC	2.4.1.18	3.2.1.1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH57	9	428	9e-76	0.804177545691906

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10792	GH57N_AmyC_like	0.0	6	418	1	412	N-terminal catalytic domain of alpha-amylase ( AmyC ) and similar proteins. Alpha-amylases (alpha-1,4-glucan-4-glucanohydrolases, EC 3.2.1.1) play essential roles in alpha-glucan metabolism by catalyzing the hydrolysis of polysaccharides such as amylose starch, and beta-limit dextrin. This subfamily is represented by a novel alpha-amylase (AmyC) encoded by hyperthermophilic organism Thermotoga maritime ORF tm1438, and its prokaryotic homologs. AmyC functions as a homotetramer and shows thermostable amylolytic activity. It is strongly inhibited by acarbose. AmyC is composed of a N-terminal catalytic domain, containing a distorted TIM-barrel structure with a characteristic (beta/alpha)7 fold motif, and two additional less conserved domains. There are other two canonical alpha-amylases encoded from T. maritime that lack the sequence similarity to AmyC, and belong to a different superfamily.
COG1543	COG1543	0.0	5	528	2	501	Predicted glycosyl hydrolase, contains GH57 and DUF1957 domains [Carbohydrate transport and metabolism].
cd10816	GH57N_BE_TK1436_like	5.82e-110	6	418	1	423	N-terminal catalytic domain of Gh57 branching enzyme TK 1436 and similar proteins. The subfamily is represented by a novel branching-enzyme TK1436 of hyperthermophilic archaeon Thermococcus kodakaraensis KOD1. Branching enzymes (BEs, EC 2.4.1.18) play a key role in synthesis of alpha-glucans and they generally are classified into glycoside hydrolase family 13 (GH13). However, TK1436 belongs to the GH57 family. It functions as a monomer and possesses BE activity. TK1436 is composed of a distorted N-terminal (beta/alpha)7-barrel domain and a C-terminal five alpha-helical domain, both of which participate in the formation of the active-site cleft.
cd01022	GH57N_like	7.26e-64	9	418	1	313	N-terminal catalytic domain of heat stable retaining glycoside hydrolase family 57. Glycoside hydrolase family 57(GH57) is a chiefly prokaryotic family with the majority of thermostable enzymes coming from extremophiles (many of these are archaeal hyperthermophiles), which exhibit the enzyme specificities of alpha-amylase (EC 3.2.1.1), 4-alpha-glucanotransferase (EC 2.4.1.25), amylopullulanase (EC 3.2.1.1/41), and alpha-galactosidase (EC 3.2.1.22). This family also includes many hypothetical proteins with uncharacterized activity and specificity. GH57s cleave alpha-glycosidic bonds by employing a retaining mechanism, which involves a glycosyl-enzyme intermediate, allowing transglycosylation.
pfam09210	DUF1957	6.85e-50	430	528	1	98	Domain of unknown function (DUF1957). This domain is found in a set of hypothetical bacterial proteins. Its exact function has not, as yet, been defined.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSQ10341.1	1.58e-217	4	529	2	527
ADG81752.1	1.77e-215	5	528	3	525
AEG15246.1	1.97e-213	5	529	3	525
AXA36063.1	1.55e-212	5	528	9	532
BAF60409.1	7.76e-211	5	529	3	527

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2B5D_X	2.16e-177	5	527	2	522	Crystalstructure of the novel alpha-amylase AmyC from Thermotoga maritima [Thermotoga maritima MSB8]
3N8T_A	9.40e-98	5	523	2	526	ChainA, alpha-amylase, GH57 family [Thermococcus kodakarensis],3N92_A Chain A, alpha-amylase, GH57 family [Thermococcus kodakarensis],3N98_A Chain A, alpha-amylase, GH57 family [Thermococcus kodakarensis]
5WU7_A	2.61e-95	5	496	2	496	Crystalstructure of GH57-type branching enzyme from hyperthermophilic archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],5WU7_B Crystal structure of GH57-type branching enzyme from hyperthermophilic archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3P0B_A	4.80e-62	9	528	25	535	Thermusthermophilus family GH57 branching enzyme: crystal structure, mechanism of action and products formed [Thermus thermophilus]
1UFA_A	3.28e-60	9	528	5	515	Crystalstructure of TT1467 from Thermus thermophilus HB8 [Thermus thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5JDJ7	9.27e-96	5	523	2	526	1,4-alpha-glucan branching enzyme TK1436 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) OX=69014 GN=TK1436 PE=1 SV=1
Q5SH28	1.71e-61	9	528	5	515	1,4-alpha-glucan branching enzyme TTHA1902 OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=TTHA1902 PE=1 SV=1
P9WQ26	5.62e-39	6	489	10	483	Probable 1,4-alpha-glucan branching enzyme MT3115 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3115 PE=3 SV=1
P9WQ27	5.62e-39	6	489	10	483	Probable 1,4-alpha-glucan branching enzyme Rv3031 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3031 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002811_01077.