CAZyme Information: MGYG000002810_00588

Basic Information

• Species: UMGS911 sp900546695
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS911; UMGS911 sp900546695
• CAZyme ID: MGYG000002810_00588
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
948		106900.06	4.6976

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002810	2116279	MAG	Peru	South America

• Gene Location: Start: 100909; End: 103755 Strand: -

Full Sequence      

MKNDIFANIAAAGIGGRQELLSRPEPVPFEPKKAALTEGGEAYGVPEKMHTEEQLRAALA
EMRERYAPFARDLAPECVSSKEIIPLSEFTLYDEDSEPRQITLPYYGAPVGRHEQLYDTR
FALRPEQTEGKAIYICIGGADYLASVYVNGVCVGVHEGFFSPFEFEITDYVNAGLNELRI
QLKNDHVFMGSKGQDGISYEGEKMYAATGPGWDDPAVGWHHCQPGMGIYSDVRIEVREQL
HISDLWVRPDIDRAEAELWVEVQSSEYGEFPVELDISVYGQNHGATVVEGMRYQPTAVRM
CGLGDTFTAALGPDSFGQGTPIPAEHGKNLYKVRIPMGEFLLWEPEMPYLYQAQVALVRD
GSVVDRASTQFGMRSFTEDTEPDESGLRGMFKLNGRPIRLRGANTMGFEQQDVMRGDIDQ
LRDDILLAKLCNMNFLRLTQRPVQDEVYKWCDRLGLMTQTDLPLFAKMRRFKFAEGVRQA
QELACMIRGHACNVVVSYMNEPTPGAGGKPHRHLTRTEMEDFFSACDLALKLCHPDCVIK
YVDGDYDPPCASLPDNHCYCMWYNGHGIDIGQLWRGYWLPTKPGWYYGCGEFGTEGLEQE
SVMRKYYPAEWLTEPFDPAHIVGAQTAPFHYFFYDDQDSIGDWIEASQRFQALGVRSMTE
SFRRDNRMISGALHLFIDAFPSGWMKTIMDCERHPKKAFFAYRDALAPIMLSLRTDRFTY
YEGEEMSVEAHICNDTQLSGDCCVRFELYRAGELVYSGERDAYMAANCAGYASSASLTAP
STADRDKYTLRGILIDADGKVLAWNELPLEVFRHVEIVPSENTRLITMLTEDTVIAGETV
RVKACGMSPVHFASRKTGHPAVVEFEPEDIRYFYDSAEDMITPIVTHTFECDAFTPILVG
GNTDADGNWHKVMIAGELVRDGMRYVVCNVDLRLENPIAERLKAALIR

Enzyme Prediction     

No EC number prediction in MGYG000002810_00588.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	97	775	5.9e-71	0.6622340425531915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.85e-30	125	464	74	366	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	4.15e-18	116	462	112	400	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK10150	PRK10150	4.02e-17	117	502	69	418	beta-D-glucuronidase; Provisional
PRK09525	lacZ	6.70e-16	117	456	124	408	beta-galactosidase.
pfam00703	Glyco_hydro_2	2.96e-13	241	374	2	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE97824.1	7.22e-295	2	917	21	1016
QUI23767.1	1.78e-280	2	946	5	1031
QNK56944.1	6.23e-279	4	947	21	1066
QDH23079.1	3.53e-273	2	947	8	1038
QBE96176.1	1.78e-272	1	947	5	1046

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	2.37e-19	110	713	77	660	Crystalstructure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
7SF2_A	2.69e-16	114	463	87	378	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5T9A_A	6.79e-16	110	461	86	374	Crystalstructure of BuGH2Cwt [Bacteroides uniformis],5T9A_B Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9A_C Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9A_D Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9G_A Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_B Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_C Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_D Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis]
6MVH_A	7.54e-15	117	621	78	530	Crystalstructure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis],6MVH_B Crystal structure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis],6MVH_C Crystal structure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis],6MVH_D Crystal structure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis]
6DDT_A	2.42e-14	117	461	69	403	mousebeta-mannosidase (MANBA) [Mus musculus],6DDU_A mouse beta-mannosidase bound to beta-D-mannose (MANBA) [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P77989	5.01e-19	126	463	68	348	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KPJ7	7.85e-17	139	463	128	390	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
Q4FZV0	2.91e-15	117	501	80	457	Beta-mannosidase OS=Rattus norvegicus OX=10116 GN=Manba PE=2 SV=1
O52847	4.20e-15	93	456	119	420	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
Q04F24	9.50e-15	91	456	95	403	Beta-galactosidase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) OX=203123 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000027	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002810_00588.