CAZyme Information: MGYG000002805_00162

Basic Information

• Species: CAG-488 sp900539465
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-488; CAG-488 sp900539465
• CAZyme ID: MGYG000002805_00162
• CAZy Family: GH2
• CAZyme Description: Beta-glucuronidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
570	MGYG000002805_1|CGC5	65568.46	4.8624

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002805	2212369	MAG	Peru	South America

• Gene Location: Start: 182388; End: 184100 Strand: +

Full Sequence      

MSIPRPEYPNPQFQRSNWINLNGEWDFAYDNENSGEEKGFYKDSSVFDKKIIVPFCPESK
LSGIGNTDFIRGVWYRKTITLPERYLDKRVVLHFGACDYITKVYVDGQFAGRHKGGYSSF
FIDITPFIKPEPITITVYAKDDTRDPLQSGGKQSYDYASHDCFYTRTTGIWQTVWIEATP
KTYINNVKYYPNAENGSLDINATVVGEGKFEAIALFVGKIMGAASASSEGGSVSLHLDLK
EKHLWNVGDGQLYDLELKFGEDEVKSYFGLRSVRLDGMKFRLNGKSVFQRLVLDQGFYPD
GIYTAPNEDALIHDIQISLDAGFNGARLHEKIFEPRFLYHCDKMGYLVWGEYPNWGLDHS
KPESVFTILPEWLEEVERDFNHPAIIGWCPFNETWDVNGRKQYDDVLAAVYDCTKALDNT
RPCIDTSGNFHVKTDIFDVHDYEQNVAMFKNNYDKLMETGELHDRFDHIQKYTKGQPTFV
SEYGGIKWSLSNVDNSWGYGNAPKTEKEFIERYKGLTEALLNNDQMLGLCYTQLYDVEQE
QNGLYCYDRTPKFDMKIFKEINSQKAAIED

Enzyme Prediction     

No EC number prediction in MGYG000002805_00162.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	12	562	5.4e-96	0.6156914893617021

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	2.05e-43	20	423	14	445	beta-D-glucuronidase; Provisional
COG3250	LacZ	7.93e-43	19	439	13	444	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	5.54e-19	13	421	33	470	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02837	Glyco_hydro_2_N	3.38e-14	21	180	4	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
pfam02836	Glyco_hydro_2_C	2.69e-09	273	422	1	157	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHQ60389.1	3.02e-261	2	569	3	570
ALS26546.1	1.76e-240	2	570	8	587
ANA78861.1	2.50e-238	2	570	5	580
AVV57223.1	2.50e-238	2	570	5	580
AWP26385.1	3.55e-238	2	570	5	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	4.98e-73	6	564	27	581	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
7VQM_A	2.94e-29	72	485	95	500	ChainA, GH2 beta-galacturonate AqGalA [Aquimarina sp.],7VQM_B Chain B, GH2 beta-galacturonate AqGalA [Aquimarina sp.],7VQM_C Chain C, GH2 beta-galacturonate AqGalA [Aquimarina sp.],7VQM_D Chain D, GH2 beta-galacturonate AqGalA [Aquimarina sp.]
3K4A_A	1.70e-28	21	484	17	508	Crystalstructure of selenomethionine substituted E. coli beta-glucuronidase [Escherichia coli K-12],3K4A_B Crystal structure of selenomethionine substituted E. coli beta-glucuronidase [Escherichia coli K-12]
6XXW_A	2.95e-28	64	560	65	587	Structureof beta-D-Glucuronidase for Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
4JHZ_A	5.43e-28	21	484	17	508	Structureof E. coli beta-Glucuronidase bound with a novel, potent inhibitor 2-[4-(1,3-benzodioxol-5-ylmethyl)piperazin-1-yl]-N-[(1S,2S,5S)-2,5-dimethoxycyclohexyl]acetamide [Escherichia coli K-12],4JHZ_B Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 2-[4-(1,3-benzodioxol-5-ylmethyl)piperazin-1-yl]-N-[(1S,2S,5S)-2,5-dimethoxycyclohexyl]acetamide [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P05804	5.33e-27	21	484	15	506	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2
P77989	1.88e-24	74	446	59	437	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KPJ7	1.16e-23	72	495	104	528	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P26257	5.94e-18	75	559	58	542	Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=lacZ PE=1 SV=1
T2KM09	9.48e-17	74	429	109	460	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002805_00162.