CAZyme Information: MGYG000002801_00315

Basic Information

• Species: Parolsenella sp900549525
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Parolsenella; Parolsenella sp900549525
• CAZyme ID: MGYG000002801_00315
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358		38940.89	5.1041

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002801	1902228	MAG	Peru	South America

• Gene Location: Start: 27847; End: 28923 Strand: +

Full Sequence      

MFGAKRDTAVKEGLAAPKLHGVNLSGWLVLEPWVTPSLFAGTGAFDEASLASAMSEARYA
KLLRNHRDEFVTEKDFAGIASRGFDAVRLQVPWYVFGESGPLPGPSVGCLSYVDRAFDWA
EAAGVSILLDVALAPGTDPGEPSSFFGDVDTFRHAMLDVAGALSSRYATRQNFLGIEPID
EVRCRTRNGLSVTEGVPPHLLRNFYRDCYEVVRSAAGTDPVIVFHDGGIAGSWRGFMSPD
RYENVWLDCHVYHYAESMNAAGPTGVRRLVDDTASYLAKARKSGLEVMVGEWSAALPIAD
AGMTPEGRIALERVYTAGQLSAFAGTAGWFFQAWKTEGRLSSWDARVALSSFERGMFD

Enzyme Prediction     

No EC number prediction in MGYG000002801_00315.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	66	312	3.6e-47	0.8675496688741722

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	2.46e-20	18	337	17	365	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	9.15e-05	66	292	20	236	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH50588.1	1.20e-196	5	358	7	360
SDR87855.1	2.79e-135	19	356	6	345
BCV19183.1	6.49e-134	19	358	6	347
QOY61077.1	4.29e-132	19	356	6	345
ADK68544.1	8.63e-132	14	356	1	345

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	1.28e-41	18	292	2	296	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	9.41e-41	18	292	2	296	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
1EQP_A	2.13e-27	19	337	9	362	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]
3O6A_A	3.12e-27	19	337	14	367	F144Y/F258YDouble Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1CZ1_A	4.03e-27	19	337	9	362	Exo-b-(1,3)-glucanaseFrom Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1CRV0	1.16e-36	19	351	42	398	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
Q5B5X8	3.62e-35	16	351	26	387	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
B0XN12	4.36e-35	19	351	42	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
Q7Z9L3	5.03e-35	18	357	30	392	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
B8N151	5.03e-35	18	357	30	392	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002801_00315.