CAZyme Information: MGYG000002797_00832

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508
• CAZyme ID: MGYG000002797_00832
• CAZy Family: GT10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361		42758.1	8.0068

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002797	1235752	MAG	United States	North America

• Gene Location: Start: 48; End: 1133 Strand: -

Full Sequence      

MKIAIVPFHSGLANDILFDKDNESTNSDDLITPYYYIKQEYEKRGVSINTLDQYNTLDSL
DCVLFFKLDYNELIRCIKSKVKRLYYFAWEPEVVDNHHSKKNLAKLEPFFNVIFTWNDDI
VDGNKYLKINYPYHFTNVIECPTRENFEKRNLLVNISGNKISFQHNELYSVRRKVISFYN
KYSCTYFSLYGRGWLKNLRVYKGVCISKKKVYTQFKFALCLENMCNVNGYVTEKIFDCFT
AGIVPVYWGASNIEKYIPKQCFISYTDFSSIDDLNHFLINMSYEEYCNYICHIKEYLQSS
AKSVFEYKYFMRQLDSALISNIERECNNEVALAFYSILQNISRKPKALFNLTTKLIVDYC
M

Enzyme Prediction     

No EC number prediction in MGYG000002797_00832.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT10	50	305	1.8e-33	0.7262247838616714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00852	Glyco_transf_10	1.29e-07	213	310	54	134	Glycosyltransferase family 10 (fucosyltransferase) C-term. This is the C-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The C-terminal domain is the likely binding-region for ADP (manuscript in publication).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ43443.1	2.08e-129	1	314	1	313
QCQ48039.1	2.08e-129	1	314	1	313
QLK80746.1	2.15e-129	1	314	2	314
QTL97700.1	6.01e-78	2	324	3	325
QGP65707.1	1.79e-60	3	329	4	326

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NZW_A	1.20e-09	207	273	224	289	CrystalStructure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_C Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZX_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZY_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori]
5ZOI_A	1.38e-09	207	273	224	289	CrystalStructure of alpha1,3-Fucosyltransferase [Helicobacter pylori],5ZOI_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O30511	8.42e-09	207	273	224	289	Alpha-(1,3)-fucosyltransferase FucT OS=Helicobacter pylori OX=210 GN=fucT PE=1 SV=1
Q9C8W3	5.38e-08	213	274	283	343	Alpha-(1,4)-fucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=FUT13 PE=2 SV=2
O88819	4.73e-06	216	278	239	302	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Mus musculus OX=10090 GN=Fut9 PE=1 SV=1
Q99JB3	4.73e-06	216	278	239	302	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Rattus norvegicus OX=10116 GN=Fut9 PE=1 SV=1
Q9LJK1	6.04e-06	206	283	254	328	Glycoprotein 3-alpha-L-fucosyltransferase A OS=Arabidopsis thaliana OX=3702 GN=FUT11 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999911	0.000122	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002797_00832.