CAZyme Information: MGYG000002789_00023

Basic Information

• Species: Lapidilactobacillus dextrinicus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lapidilactobacillus; Lapidilactobacillus dextrinicus
• CAZyme ID: MGYG000002789_00023
• CAZy Family: GH73
• CAZyme Description: Exo-glucosaminidase LytG

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
212	MGYG000002789_1|CGC1	23986.03	6.9905

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002789	1826765	MAG	United States	North America

• Gene Location: Start: 19468; End: 20106 Strand: +

Full Sequence      

MTKRRSSHNLFQSGITNLGLIIIAIIISAVLLLALVDRQQATKPKEATTTMAQSTNSSEK
QDFIDKVAPEAVKLKATYQVLPSITIAQAILESDWGQSQLTAKYNNLFGVKGDRTENTKE
MTTQEYLNGEWKTVTARFRVYASYRDSLLEHAQLFHKGTTWNANQYQHFLAAKNYQEAAK
ALETDGYATDPGYAEKLIELIQQYHLDDYDKQ

Enzyme Prediction     

No EC number prediction in MGYG000002789_00023.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	68	206	1.2e-37	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	2.17e-64	52	211	35	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	6.80e-38	55	211	315	473	amidase domain-containing protein.
smart00047	LYZ2	1.38e-37	61	210	9	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
NF038016	sporang_Gsm	2.35e-31	47	210	151	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
PRK05684	flgJ	1.60e-29	39	203	131	296	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFG46116.1	5.46e-145	1	212	1	212
QFR65417.1	6.93e-69	37	210	8	176
ANY13270.1	4.17e-68	2	211	10	225
QEU48791.1	5.64e-68	60	210	26	176
QFR25253.1	5.64e-68	60	210	26	176

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	7.86e-26	61	210	31	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5DN5_A	6.65e-21	61	203	4	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	9.51e-21	61	203	4	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	7.78e-19	61	201	2	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5T1Q_A	8.57e-19	56	212	56	214	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.32e-48	59	211	47	199	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
A2RHZ5	1.03e-25	46	210	49	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P0C2T5	2.72e-25	46	210	49	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
Q9CIT4	3.81e-25	46	210	49	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
P39046	1.16e-20	63	210	65	214	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999717	0.000193	0.000003	0.000001	0.000001	0.000115

TMHMM  Annotations     

start	end
13	35