CAZyme Information: MGYG000002784_01078

Basic Information

• Species: Porphyromonas sp900538385
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas; Porphyromonas sp900538385
• CAZyme ID: MGYG000002784_01078
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333	MGYG000002784_21|CGC1	38264.87	5.0705

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002784	2012007	MAG	United States	North America

• Gene Location: Start: 20870; End: 21871 Strand: -

Full Sequence      

MNCSRWNEIRRDPTRMRRLLRSITLSLWGAVLVGVVYYFVVVYQVPQPKTSREHIALQNE
WHDVPIAEVGAGEDYEELEQYGTLYALEYLLDYDSIWPNAEVNRLKLLELYEEEEDEEED
DEEVVVQVKVVPAKPTSTPETSPEQSTRHQGVISDWDHLFQQYGNKYGWDWCVLAAIAYQ
ESKFRAEVVGMGGATGLMGIMPATGRRYGYNRAKLKHAESSVRIACMALRDFGRAFAHIS
DSEQRMKFTLASYNSGSAHVLDARRLAERDGLDPDRWDESVEIYMARLNEPKYYNDPLVQ
HGRANGAHTVRYVAEVFSRAQSYKSKVQYATAE

Enzyme Prediction     

No EC number prediction in MGYG000002784_01078.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	168	329	8.4e-20	0.8666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	5.81e-64	160	324	1	160	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG4623	MltF	6.34e-29	150	316	265	424	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
PRK10859	PRK10859	8.85e-26	150	314	284	441	membrane-bound lytic murein transglycosylase MltF.
cd13401	Slt70-like	7.19e-14	159	281	9	130	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	1.60e-11	160	267	1	106	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE12384.1	1.36e-184	1	333	1	331
BAK25352.1	7.72e-52	137	326	274	471
AUR47574.1	7.72e-52	137	326	274	471
AKV63991.1	4.15e-51	150	326	293	471
ALO29436.1	4.15e-51	150	326	293	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AA4_B	2.31e-15	147	316	242	407	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA1_A	2.58e-15	147	316	290	455	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013],5AA1_B Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013],5AA1_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013],5AA1_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA2_A	2.58e-15	147	316	290	455	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013],5AA2_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]
5AA2_B	2.58e-15	147	316	290	455	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]
5AA2_D	2.58e-15	147	316	290	455	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0AQY9	1.21e-18	148	316	281	444	Membrane-bound lytic murein transglycosylase F OS=Maricaulis maris (strain MCS10) OX=394221 GN=mltF PE=3 SV=2
A8ZWR8	5.41e-18	159	326	289	451	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
Q47XX8	1.15e-17	151	316	277	435	Membrane-bound lytic murein transglycosylase F OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) OX=167879 GN=mltF PE=3 SV=2
Q6LU25	1.60e-17	150	332	287	459	Membrane-bound lytic murein transglycosylase F OS=Photobacterium profundum (strain SS9) OX=298386 GN=mltF PE=3 SV=1
A1U3J1	2.10e-17	159	316	289	441	Membrane-bound lytic murein transglycosylase F OS=Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8) OX=351348 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	42