CAZyme Information: MGYG000002777_00875

Basic Information

• Species: Dialister sp900545785
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; Dialister; Dialister sp900545785
• CAZyme ID: MGYG000002777_00875
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
194		21629.63	4.3862

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002777	1462546	MAG	United States	North America

• Gene Location: Start: 5789; End: 6373 Strand: +

Full Sequence      

MNNLSGRAEVPHSENSWGKKIFTALLALLSLLCFYILSDIPVWKPSPAIQEIINESAARE
DLSPYLIEAVMYTESKFDEKAVSKMGAVGVMQLMPETAAWISEESGLPADHLADPAENIP
LGSWYLNFLLKKYHNNEVLALAAYNAGRGNVDEWIEELGWEEGFSNINAIPFPETREFIK
SVVTVRDKLQEGGK

Enzyme Prediction     

No EC number prediction in MGYG000002777_00875.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	57	188	1.5e-28	0.8444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.95e-68	50	182	5	140	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	9.75e-50	48	184	5	144	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	3.68e-41	64	184	1	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	1.20e-32	53	164	1	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	2.38e-29	50	182	140	276	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK24355.1	1.50e-78	7	190	9	192
AOH39655.1	9.22e-59	1	191	1	188
ALG43012.1	3.84e-46	18	183	9	179
AVO73570.1	3.09e-45	18	183	9	179
AVO26251.1	3.09e-45	18	183	9	179

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	5.65e-19	50	183	417	549	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	5.66e-19	50	183	421	553	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	5.69e-19	50	183	427	559	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	5.70e-19	50	183	431	563	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	5.72e-19	50	183	437	569	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	3.75e-20	48	185	59	178	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P39434	3.73e-17	48	183	479	619	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC4	1.73e-16	48	183	479	619	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	1.73e-16	48	183	479	619	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P44888	3.12e-16	48	183	427	566	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000012	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
21	43