CAZyme Information: MGYG000002774_00151

Basic Information

• Species: Schleiferilactobacillus harbinensis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Schleiferilactobacillus; Schleiferilactobacillus harbinensis
• CAZyme ID: MGYG000002774_00151
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
417	MGYG000002774_1|CGC2	47403.2	7.1112

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002774	3078759	MAG	United States	North America

• Gene Location: Start: 150053; End: 151306 Strand: -

Full Sequence      

MSVLDWCLLVAITTIWLILVVNVVLVIAGYLEYLQQVKRPVPALPQVPPFVSVMVPAHNE
GIVIVKTVEALLRFDYPQDRYEIIVINDNSDDDSAVLLAALQRQHPDRQLTIVNTDAANG
GRGKSNALNIGLAAAQGEVLAIYDADNTPEAGALRILVSELMADDSLGAVIGKFRTRNRH
ATLLTRFINIETLSFQWMAQAGRQHLFGLCTIPGTNYVIRRELIDAIGGWDVQALAEDTE
ISFHVYLHHLRILFQPRAVTWEQEPQTLPVWFHQRTRWVKGNIYVILKNLPLLAKPSARI
IHFDLLYYLAIYFLLMASLVLSDIVFVFSVAGVVHSHLQGFSNTLWLLAIILFVVSTYTT
ITTEKGERNFNNVWIIILMYVTYSQLWLAVAVYGMGEYIREQVFHKQARWYKTKRFE

Enzyme Prediction     

No EC number prediction in MGYG000002774_00151.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	49	280	1e-37	0.991304347826087

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	4.10e-62	53	238	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	1.94e-59	3	416	15	425	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	3.03e-47	30	358	35	362	N-glycosyltransferase; Provisional
cd06427	CESA_like_2	5.86e-35	49	281	1	229	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.
pfam13641	Glyco_tranf_2_3	8.33e-35	48	281	1	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFR25096.1	1.57e-297	1	417	1	417
QEU48060.1	2.23e-297	1	417	1	417
QFR63496.1	3.16e-297	1	417	1	417
QFR68103.1	1.74e-225	1	417	1	417
QLE65212.1	2.80e-225	2	417	15	430

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YV7_B	2.45e-14	49	266	42	250	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	2.47e-14	49	266	43	251	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
7LBY_A	1.44e-11	24	295	245	514	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
6P61_A	6.65e-08	49	186	13	142	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	1.59e-112	10	416	8	414	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
P74165	4.69e-27	49	281	108	335	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
Q8YMK0	2.71e-26	49	295	106	347	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
Q3MB01	2.71e-26	49	295	106	347	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1
Q8GLC5	1.33e-25	51	289	49	278	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29
306	328
341	363
373	395